Conserved Protein Domain Family
2a6301s02

?
TIGR00943: 2a6301s02 
monovalent cation:proton antiporter
This family of proteins constists of bacterial multicomponent K+:H+ and Na+:H+ antiporters. The best characterized systems are the PhaABCDEFG system of Rhizobium meliloti which functions in pH adaptation and as a K+ efflux system and the MnhABCDEFG system of Staphylococcus aureus which functions as a Na+:H+ antiporter.This family is specific for the phaB and mnhB proteins. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130018
View PSSM: TIGR00943
Aligned: 4 rows
Threshold Bit Score: 130.642
Threshold Setting Gi: 4001726
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA35096      28 LFLAGHYTPGGGFVGGLLFASSLVIITIAFDIETMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFI 107 Staphylococcus ...
CAA63735     124 LFLRGHDLPGGGFAAGIAMSIGFILQYMSGGTRWVEERLRIHPLRWMSIGLLVATATGVGSWFFGYPFLTSHAQYASLPV 203 Sinorhizobium m...
WP_010887526  60 LLWRGHNAPGGGFIAGLMTACALILHRIATGEDALR----TDPARLIPWGAALSFVTGLVPYLLGRPFLKSDYGYFTTAL 135 Deinococcus rad...
WP_003228819  29 LFLSGHNAPGGGFVGGLITSSSIVLLLLAYDLKTVRSLLPVNFIYVAGAGLLLAVLTGVGSFVFGAPFLTHTFGYFQLPI 108 Bacillales
BAA35096     108 LEPVHMTTAVFFDFGVLCAVVGTVMTI 134 Staphylococcus aureus
CAA63735     204 VGKFPLASAILFDLGVFSLVLGATVLI 230 Sinorhizobium meliloti
WP_010887526 136 TGEFEWATAMLFDIGVFAVVVGSTMLI 162 Deinococcus radiodurans
WP_003228819 109 LGKTELATATIFDLGVYLVVVGITMTI 135 Bacillales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap