Conserved Protein Domain Family
2a6301s05

?
TIGR00942: 2a6301s05 
Monovalent Cation (K+ or Na+):Proton Antiporter-3 (CPA3) subfamily
[Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130017
View PSSM: TIGR00942
Aligned: 3 rows
Threshold Bit Score: 198.136
Threshold Setting Gi: 489624396
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA35099      15 WLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGR----FYVITLYRIIKLVIIFLIELIKANFDVLKIIIKP-SIKNEPG 89  Staphylococcus ...
WP_010885538  27 WLFLTASLDPQELIVGIIFSAIVAGFTYDIFTTRglsnLHPRRIAYAIIYIPYFLWAMIKANLDVAYRVLHP-KRPINPG 105 Pyrococcus hori...
WP_003528836  18 wlllSQSVTPGSIVLGLVVSTVLAWVTLNLQPAR----SRLHRWSRIAGFILRVVGDVIRSNIAVTLIILRAgRRPVNAG 93  Sinorhizobium m...
BAA35099      90 FFVYHTDLKKDWQIVLLSNLITLTPGTVVLGVSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGE 158 Staphylococcus aureus
WP_010885538 106 IVECKTELKNEVGKLALANSITLTPGTITLDIDGDRYFIHWIDVKDSSIEGASEHITKPFEKFLKVIFE 174 Pyrococcus horikoshii
WP_003528836  94 FMTVSLDLDDENALALLACVVTATPGTAWLEYDRRQKILLFHVLDIENEDLWRKTITR-YAADLKEIFE 161 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap