Conserved Protein Domain Family
2a38euk

?
TIGR00934: 2a38euk 
potassium uptake protein, Trk family
The proteins of the Trk family are derived from Gram-negative and Gram-positive bacteria, yeast and wheat. The proteins of E. coli K12 TrkH and TrkG as well as several yeast proteins have been functionally characterized.The E. coli TrkH and TrkG proteins are complexed to two peripheral membrane proteins, TrkA, an NAD-binding protein, and TrkE, an ATP-binding protein. This complex forms the potassium uptake system. This family is specific for the eukaryotic Trk system. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130009
View PSSM: TIGR00934
Aligned: 8 rows
Threshold Bit Score: 537.644
Threshold Setting Gi: 567062
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P28569      3 IRGTMSRVPTLASFEVRyk--kSFGHKFRDFIALCGHYCSPIKKYIFPNFIAVHYFYTIVLT-LITSILLYP---VKNIR 76   Saccharomyces uvarum
P12685      3 FRRTMSRVPTLASLEIRyk--kSFGHKFRDFIALCGHYFAPVKKYIFPSFIAVHYFYTISLT-LITSILLYP---IKNTR 76   Saccharomyces cer...
P28584      4 AKRTSSRASLALPFQLRlvhkkSWGHRLRDFISGFLKSCRPIAKYVFPNFIVVHYIYLITLS-IIGSILLYP---CKNTA 79   Saccharomyces cer...
AAD30128    2 IFRKVVRNPTVQNIQIYr---kTLGHQIRDIIEKLTKKIDPFVKFIFPNFIAFHYFYIIAFA-LLCSILIYP---VKNFA 74   Kluyveromyces lactis
CAA08813    1 ----MERLRSITQEK------------WAWICHHIGFRPRKLMTEGHFQYQTVHYTLIIGLT-IVGSILIYAs-hRGQVA 62   Neurospora crassa
P47946      1 --------------------------MVLNYIQRWFKWVIPTFG-----FLAIHYIYIISLT-IIASILLFTggtTTKIK 48   Schizosaccharomyc...
AAA52749    1 MGRVKRFYQDFIHIKLH-----SFCRISGYVVDSIAFVYRFVALHVHPFWIQLSYFLAIAILgSVLLMSLKPsnpDFSPP 75   bread wheat
AAC62807    1 ------------MDR---------------VVAKIAKIRSQLTKLRSLFFLYFIYFLFFSFLgFLALKITKPrttSR-PH 52   thale cress
P28569     77 YIDALFLAAGAVTQGGLNTVDVNNLTLYQQIILYIICCISTPIAVHSCLAFVRLYWFERYFDGIRDSSRLNF-KMRRTKT 155  Saccharomyces uvarum
P12685     77 YIDTLFLAAGAVTQGGLNTVDINNLSLYQQIVLYIVCCISTPIAVHSCLAFVRLYWFERYFDGIRDSSRRNF-KMRRTKT 155  Saccharomyces cer...
P28584     80 FIDVLFLAAGASTQGGLATKSTNDFNLYQQIVVYVITLLSTPILIHGFLAFVRLYWFERYFDNIRDISKQNF-KLRRTMT 158  Saccharomyces cer...
AAD30128   75 YIDILFLATGAATQGGLNTVDLNELSLYQQIVLYITTALTTPIFIHSGLAFVRFYWFERYFDGIRDWSKRDF-EMRRTMT 153  Kluyveromyces lactis
CAA08813   63 YVDALFFAAGACTQGGLNTIDVNLINTFSQAVIFLLAMLTNPISIGYYTVSLRRYWFEKKLQTIVQDAKQRRgTISKSKS 142  Neurospora crassa
P47946     49 YIDALFLASSATTQTGLNSVDLNSLSIWQQFILYGFTAITVPIWMHGSISFIRLYWFRRKFKDVVRQNRTRK-FQRKLRK 127  Schizosaccharomyc...
AAA52749   76 YIDMLFLSTSALTVSGLSTITMEDLSSSQIVVLTLLMLIGGEIFVS---------------------------LLGLMLR 128  bread wheat
AAC62807   53 DFDLFFTSVSAITVSSMSTVDMEVFSNTQLIFLTILMFLGGEIFTS---------------------------FLNLYVS 105  thale cress
P28569    156 ILERELTARTMTKSKTGgt-------qrVSRPGKSDKRDDFQEKLFNGEMVNRDEqdsvhSSHNSRDSNsnantnssnnn 228  Saccharomyces uvarum
P12685    156 ILERELTARTMTKNRTGtq--------rTSYPRKQAKTDDFQEKLFSGEMVNRDEqdsvhSDQNSHDISrdssnnntnhn 227  Saccharomyces cer...
P28584    159 LQQRELSG---S---SG-----------N-----AARSRSFKDNLFRGKFVSRED-----PRQSASDVPmd--------- 202  Saccharomyces cer...
AAD30128  154 LRQRELTKNNTMENASRstgqgplnfltRTFTHGDRDASNFQGRLFRGEVVKRDE-------DNNDDSS----------- 215  Kluyveromyces lactis
CAA08813  143 QMRTDFLSQAERGVAGRe----------ITVMHGSGSPRMTNDGILLGSFQKPTYdsrapPDQRDPDQP----------- 201  Neurospora crassa
P47946    128 SLMKKSEDDEEQGVRGRki--------rVMLPYLHSLRSPTSLKNFS-RFDTHDStnnpyFPDNPPSPK----------- 187  Schizosaccharomyc...
AAA52749  129 VNHQDMQDLP--------------------------------------------------------SVK----------- 141  bread wheat
AAC62807  106 YFTNSIEDR----------------------------------------------------------------------- 114  thale cress
P28569    229 sinhngssgslddyvredkadevekyhgnksyssvgssSNTATDENISqklkpsslrfdesqnKRKrtgapSEKFAKRRG 308  Saccharomyces uvarum
P12685    228 gssgslddfvk-----edetddngeyqennsystvgssSNTVADESLNqkpkpsslrfdephsKQRparvpSEKFAKRRG 302  Saccharomyces cer...
P28584    203 -------------------------------------sPDTSALSSISplnvs------sskeESSdtqssPPNFSSKRQ 239  Saccharomyces cer...
AAD30128  216 --------------------------------------VDTRPPEAHS---------------DHT------EKFIGRRK 236  Kluyveromyces lactis
CAA08813  202 --------------------------------------EDTRRQPEIR-----------------------FAGTVKKSD 220  Neurospora crassa
P47946    188 --------------------------------------ADISKDEYFGkylpkk---sdtldmDLEshnmtFHDYEPSIE 226  Schizosaccharomyc...
AAA52749  142 ----------------------------------------------IS-------------------------------- 143  bread wheat
AAC62807      --------------------------------------------------------------------------------      thale cress
P28569    309 SRDITPEDMYRSIMMLQGEHEgtaedegpplvigsptdgtrnmdngsesksaptmneskiRIQDKgakisldqdsvlHSS 388  Saccharomyces uvarum
P12685    303 SRDISPADMYRSIMMLQGKHEataedegpplvigspadgtryksnvnklkkatgingnkiKIRDKgnesntdqnsvsSEA 382  Saccharomyces cer...
P28584    240 PSDVDPRDIYKSIMMLQ-------------------------------------------KQQEK------------SNA 264  Saccharomyces cer...
AAD30128  237 SRDINPADMYRSIAMLQNRHEsndnikgp------------------------alvikspAEREKe----------iEEQ 282  Kluyveromyces lactis
CAA08813  221 GLGLDAIKLPRSDEEHIAILE----------------------------------------------------------- 241  Neurospora crassa
P47946    227 NKNYDFGSSHSASMQMYEMDDlh------------------------------------pRLRRQss--------fiSSV 262  Schizosaccharomyc...
AAA52749  144 SVPVELEELDLPNSMAL--------------------------------------------------------------- 160  bread wheat
AAC62807      --------------------------------------------------------------------------------      thale cress
P28569    389 NSsacTSDEDSlptnfggttpslsakpreSSSgpiaftegenadrkqgpsiqfnitkpprkaskskrvstmddlnprsif 468  Saccharomyces uvarum
P12685    383 NStasVSDESSlhtnfgnkvpslrtnthrSNSgpiaitdnaetdkkhgpsiqfditkpprkiskr--vstfddlnpkssv 460  Saccharomyces cer...
P28584    265 NS----TDSFS------------------SETngp--------------------------------------------- 277  Saccharomyces cer...
AAD30128  283 RRlqkEREEQQ------------------GQS------------------------------------------------ 296  Kluyveromyces lactis
CAA08813  242 -----RQRNR---------------------------------------------------------------------- 246  Neurospora crassa
P47946    263 NPleaDDTRETl-----------------SEGa----------------------------------------------- 278  Schizosaccharomyc...
AAA52749      --------------------------------------------------------------------------------      bread wheat
AAC62807      --------------------------------------------------------------------------------      thale cress
P28569    469 phqkksskgyimkhlpkarrIRQQIKRRLSTGSIDKNSssdaldrglisglnddddgnegdnmeeyfad----nesgded 544  Saccharomyces uvarum
P12685    461 lyrkkaskkylmkhfpkarrIRQQIKRRLSTGSIEKNSsnnvsdrkpitdmddddddddndgdnneeyfadnesgdeder 540  Saccharomyces cer...
P28584    278 -----------------afiVQERHERRAPHCSLKRHSvlp--------------------------------------- 301  Saccharomyces cer...
AAD30128  297 --------------------IQFKVEPRPTKSTRSTFEps---------------------------------------- 316  Kluyveromyces lactis
CAA08813  247 ---------------------DDEVLRIPGPRDMERG------------------------------------------- 262  Neurospora crassa
P47946    279 -------------------lVQESLPMAYSYSDTNLVVs----------------------------------------- 298  Schizosaccharomyc...
AAA52749      --------------------------------------------------------------------------------      bread wheat
AAC62807      --------------------------------------------------------------------------------      thale cress
P28569    545 drmqqsepqsgselklkqqqqhqlQqNLHRMYKTKSFDdnrsKPVLMERSKTIDMAEARDLNELARTPDFQKMVYKNWKA 624  Saccharomyces uvarum
P12685    541 vqqsephsdselkshqqqqekhqlQqNLHRMYKTKSFDdnrsRAVPMERSRTIDMAEAKDLNELARTPDFQKMVYQNWKA 620  Saccharomyces cer...
P28584    302 ----------------------ssQ-ELNKLAQTKSFQ----KLLGLRR-------DEGDHDYFDGAP-HKYMVTK---- 342  Saccharomyces cer...
AAD30128  317 ----------------------giRkSFTRRKRPSFFKg--sQSARIIRDKLRRRSKGSDVNNVDDEEEEQDGHDADMEG 372  Kluyveromyces lactis
CAA08813  263 --------------------------AKPRRVDDSAEEddrePAQRAPMVTLNGRAQAITIEEPDRNKLYETLTEDFVDD 316  Neurospora crassa
P47946    299 ------------------------RdSFTLTGDDNLFP----E-GGLRPANTIDGIVRSSLSSSSLSKDTEPSTVDMHIA 349  Schizosaccharomyc...
AAA52749  161 ----------------------------------------------------------CDESQLEEAA------------ 170  bread wheat
AAC62807  115 ----------------------------------------------------------CDVETVTDYR------------ 124  thale cress
P28569    625 HHRNKPNFKRRGWNGKMFEHGPYTSDSDHNYQDNGNnsnsivhyaesilHRDNSHRNGSEDVSSDSNEttyplngnndhs 704  Saccharomyces uvarum
P12685    621 HHRKKPNFRKRGWNNKIFEHGPYASDSDRNYPDNSNtgnsilhyaesilHHDGSHKNGSEEASSDSNEniystng--gsd 698  Saccharomyces cer...
P28584    343 ---KKKISRTQSCNIPTYTASPSPKTSGQVVENHRNl------------AKSAPSSFVDEEMSFSPQEsln--------- 398  Saccharomyces cer...
AAD30128  373 SSEDDSVIESSDGQSESISAPNFDHHSSEPTLQSGG-------------TVSAPSSLESNEIEEEDEEls---------- 429  Kluyveromyces lactis
CAA08813  317 AKMFTHSFVPQLNHLKFRKNTRAPTRNRGDEEADP--------------KLQRSNSRMSRRPSLSAMR------------ 370  Neurospora crassa
P47946    350 FTGLNKPTIERERNLKLRKKSRFYKKSLRSRFSRGLh-----------rPIRWTKSFTSNRRNLTLER------------ 406  Schizosaccharomyc...
AAA52749      --------------------------------------------------------------------------------      bread wheat
AAC62807      --------------------------------------------------------------------------------      thale cress
P28569    705 qndaNGYPTYNDEEEgyyglhfdsdynlDPHHALSSNASKNYLSWQPTIGRNSNFLGLTRAQKDELGGVEYRAIKLLCTI 784  Saccharomyces uvarum
P12685    699 hnglNNYPTYNDDEEgyyglhfdtdydlDPRHDLSKGSGKTYLSWQPTIGRNSNFLGLTRAQKDELGGVEYRAIKLLCTI 778  Saccharomyces cer...
P28584    399 -lqfQAHPPKPKRREg------------DIGHPFTRTMSTNYLSWQPTFGRNSVFIGLTKQQKEELGGVEYRALRLLCCI 465  Saccharomyces cer...
AAD30128  430 --dlPTGVSYYGLHSg-----------gDPRNRLNRVMSTNYLSYEPKIGRNSTFVGLSESQKVELGGVEYRSTKVLCLL 496  Kluyveromyces lactis
CAA08813  371 -----------------------------SAFTKDKMEPTPYLSWEPTLGRNSQFHDLTEEQREELGGIEYRVLKLLQKI 421  Neurospora crassa
P47946    407 ----VLSSAFAKKRE-------------PSISSRHTTMSLPYLSYNPTVDRNSAFVALSKEQRDELGGIEYRALKCVCSM 469  Schizosaccharomyc...
AAA52749  171 -------------------------------------HA------------------IPPKKCTEL--KRSRSVKCLGYV 193  bread wheat
AAC62807  125 -------------------------------------EG------------------LIK--------IDERASKCLYSV 141  thale cress
P28569    785 LVVYYVGWHIVSFVMLVPWINLKKHYSDIVRSDGVSPTWWGFWTAMSAFNDLGLTLTPDSMMSFDKAVYPLIVMIWFIII 864  Saccharomyces uvarum
P12685    779 LVVYYVGWHIVAFVMLVPWIILKKHYSEVVRDDGVSPTWWGFWTAMSAFNDLGLTLTPNSMMSFNKAVYPLIVMIWFIII 858  Saccharomyces cer...
P28584    466 LMVYYIGFNILAFVTIVPWACTRHHYSEIIRRNGVSPTWWGFFTAMSAFSNLGLSLTADSMVSFDTAPYPLIFMMFFIII 545  Saccharomyces cer...
AAD30128  497 LSIYYLGFSILAMIIFAAWIQPMNNYKEIVRSQGVSPTWWGFWTGMSAFGNLGLTLTPNSMISFHKSIYTLIWMMWFIVI 576  Kluyveromyces lactis
CAA08813  422 ILCYFFGFFLLGLVGLLPWILHEDRWGQVVDQAGQSRVWWAFFTANSAFMDLGLTLTPDSMNSFNTAVWPLLLMIFLIII 501  Neurospora crassa
P47946    470 VTLYFIIFNIAAFVTFIVFAYTAVGSREVIDSYDLRRGWWALFSSASSFNDLGFSLIPSSFVPMNRNIFLLLISSLFIIA 549  Schizosaccharomyc...
AAA52749  194 VFGYFAMIHVLGFLLVFLYITHVPTASAPLNKKGINIVLFSLSVTVASCANAGLVPTNENMVIFSKNSGLLLLLSGQMLA 273  bread wheat
AAC62807  142 VLSYHLVTNLVGSVLLLVYVNFVKTARDVLSSKEISPLTFSVFTTVSTFANCGFVPTNENMIIFRKNSGLIWLLIPQVLM 221  thale cress
P28569    865 GNTGFPILLRCIIWIMFKLSPDLSQMRESLGFLLDHPRRCFTLLFPKAATWWLLLTLVGLNFTDWILFIILDFGSTVVKS 944  Saccharomyces uvarum
P12685    859 GNTGFPILLRCIIWIMFKISPDLSQMRESLGFLLDHPRRCFTLLFPKAATWWLLLTLAGLNITDWILFIILDFGSTVVKS 938  Saccharomyces cer...
P28584    546 GNTGFPIMLRFIIWIMFKTSRDLSQFKESLGFLLDHPRRCFTLLFPSGPTWWLFTTLVVLNATDWILFIILDFNSAVVRQ 625  Saccharomyces cer...
AAD30128  577 GNTGFPIFLRFVIWILFKLSPDLSLRKDSLGFLLDHPRRCFTMLFPKAATWWLFLILIGMNAIDLILFIILDLNTDVVKD 656  Kluyveromyces lactis
CAA08813  502 GNTGFPVMLRFIIWVMSIVVPRDSGLYEEVRFLLDHPRRCFILLFPSGATWWLFFILIGLNCADVVFFVVLDLGSGPVDA 581  Neurospora crassa
P47946    550 GNTGFPCFFRTFIWTTYKLYPFSFEKKEAMAFLLDHPRRCFTLLFPSGATWVLFFVLLLLNVIDLVLFMVLDTGSKAVAS 629  Schizosaccharomyc...
AAA52749  274 GNTLFPLFLRLLVWFLGRIT----KVKELRLMINNPEEVRFANLLARLPTVFLSSTVVGLVAAGVTMFCAVDWNSSVFDG 349  bread wheat
AAC62807  222 GNTLFPCFLVLLIWGLYKIT----KRDEYGYILKNHNKMGYSHLLSVRLCVLLGVTVLGFLIIQLLFFCAFEWTSESLEG 297  thale cress
P28569    945 LSKGYRVLVGLFQSVSTRTAGFSVVDLSQLHPSIQVSYMLMMYVSVLP-LAISIRRTNVYEEQSLGLYgemggkpedtdt 1023 Saccharomyces uvarum
P12685    939 LSKGYRVLVGLFQSVSTRTAGFSVVDLSQLHPSIQVSYMLMMYVSVLP-LAISIRRTNVYEEQSLGLYgdmggepedtd- 1016 Saccharomyces cer...
P28584    626 VAKGYRALMGLFQSVCTRTAGFNVVDLSKLHPSIQVSYMLMMYVSVLP-LAISIRRTNVYEEQSLGLYdsgqdde----- 699  Saccharomyces cer...
AAD30128  657 LTAGFKVLNGLFQAVSTRTAGFAVLDLSQLHPSVQVSYMLMMYVSVMP-LAISIRRTNVYEEQSLGVYg----------- 724  Kluyveromyces lactis
CAA08813  582 LPGGIKVLNGLFEAASTRTAGFSCINLAVLHPAVKVSYMIMMYISVLP-IAMSIRRTNVYEEKSLGIYn----------- 649  Neurospora crassa
P47946    630 LPKGIRVVNAIFQSVCTRTAGFTSVSISELHPAVLVSYMVMMYISVYP-VAINMRNTNVYEERSLGVY------------ 696  Schizosaccharomyc...
AAA52749  350 LSSYQKTVNAFFMVVNARHSGENSIDCSLMSPAIIVLFIVMMYLPSSAtFAPPSGDTKTTNENTKGKV------------ 417  bread wheat
AAC62807  298 MSSYEKLVGSLFQVVNSRHTGETIVDLSTLSPAILVLFILMIGL------------------------------------ 341  thale cress
P28569   1024 eedgdcddedddNEEEESHEGgssqrgkskketk---kkkkrkenenpnEESTKSFIGAHLRRQLSFD-LWFLFLGLFII 1099 Saccharomyces uvarum
P12685   1017 --teddgndeddDEENESHEGqssqrsssnnnnnnnrkkkkkkktenpnEISTKSFIGAHLRKQLSFD-LWFLFLGLFII 1093 Saccharomyces cer...
P28584    700 ------nithedDIKETDHDGeseerdtv-------------stkskpkKQSPKSFVGAHLRRQLSFD-LWYLFLGLFII 759  Saccharomyces cer...
AAD30128  725 -----------eWEKNQEDDGs---------------------------EKNTKSFIGAHLRRQLSFD-LWYMFLGLFII 765  Kluyveromyces lactis
CAA08813  650 ------------NPEGEEESAs---------------------------PSSDLSYIGSHLRRQLSFD-LWFIALFFFML 689  Neurospora crassa
P47946    697 --------------RTEDDEG--------------------------------KSFLKDHLTEQLSYD-LWYIFLGLFII 729  Schizosaccharomyc...
AAA52749  418 -----------------KR-G-------------------------------------S-LVQNLAFSpLGCNIIFVMVA 441  bread wheat
AAC62807  342 ------------------------------------------------------------IVSQLSFL-----TICIFLI 356  thale cress
P28569   1100 CICERDKIKDIQRPNFNVFTILFEIV------SAYGTVGLSLGYPNT--------------NQSFSRQLTTLSKLIIIAM 1159 Saccharomyces uvarum
P12685   1094 CICEGDKIKDVQEPNFNIFAILFEIV------SAYGTVGLSLGYPDT--------------NQSFSRQFTTLSKLVIIAM 1153 Saccharomyces cer...
P28584    760 CICEGRKIEDVNKPDFNVFAILFEVV------SAYGTVGLSLGYPNT--------------NTSLSAQFTVLSKLVIIAM 819  Saccharomyces cer...
AAD30128  766 CICEGGKIQDPSKPSFTVFQCLFEVV------SAYGTVGLSLGYPGS--------------NQSFSGQFTTISKLVIIAM 825  Kluyveromyces lactis
CAA08813  690 AISEGTRIMD---GETDMFALMFEVI------SAYGTVGMSLGFSTG--------------NASLSAIFSTTGKVFIIMT 746  Neurospora crassa
P47946    730 CICEGGKISNPLDTDFSIFTVLFEVV------SAYGTVGLSTGLSSS--------------NCSLSARFTTISKLVIIAL 789  Schizosaccharomyc...
AAA52749  442 CITERRRLRN-DPLNFSTLNMIFEVI------SAYGNAGLSTGYSCSrlhqlhpeiicqdkPYSFSGWWSDGGKFVLILV 514  bread wheat
AAC62807  357 SITERQNLQR-DPINFNVLNITLEVIryfcngSAYGNVGFTTGYSCErrvdisd-ggckdaSYGFAGRWSPMGKFVLIIV 434  thale cress
P28569   1160 LIRGKNRGLPYSLDRAIILP 1179 Saccharomyces uvarum
P12685   1154 LIRGKNRGLPYSLDRAIILP 1173 Saccharomyces cerevisiae S288c
P28584    820 LIRGRNRGLPYTLDRAIMLP 839  Saccharomyces cerevisiae S288c
AAD30128  826 LIRGRHRGLPYTLDRAIILP 845  Kluyveromyces lactis
CAA08813  747 LIRGRHRGLPYGLDRAIVLP 766  Neurospora crassa
P47946    790 ELRGRHRGLPRAVDRAILLP 809  Schizosaccharomyces pombe 972h-
AAA52749  515 MLYGRLKAFTLATGKSWKV- 533  bread wheat
AAC62807  435 MFYGRFKQFTAKSGRAWILY 454  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap