Conserved Protein Domain Family
2A0601

?
TIGR00914: 2A0601 
heavy metal efflux pump, CzcA family
This model represents a family of H+/heavy metal cation antiporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Detoxification, Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129992
View PSSM: TIGR00914
Aligned: 8 rows
Threshold Bit Score: 1676.84
Threshold Setting Gi: 2506614
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q44586      1 MIESILSGAVRFRWLVLFLTAVVGAIGAWQLNLLPIDVTPDITNKQVQINTVVPTLSPVEVEKRVTYPIETAIAGLNGVE 80   Achromobacter xyl...
P13511      1 MFERIISFAIQQRWLVLLAVFGMAGLGIFSYNRLPIDAVPDITNVQVQVNTSAPGYSPLETEQRATYPIEVVMAGLPGLE 80   Cupriavidus metal...
P94177      1 MFERIISFAIQQRWLVLLAVFGMAGLGIFSYNRLPIDAVPDITNVQVQVNTSAPGYSPLETEQRVTYPIEVVMAGLPGLE 80   Alcaligenes sp. CT14
CAB56471    1 MFERIIQFAIEQRWLVLLAVLGMAGVGIGSYQKLSIDAVPDITNVQVQINTAAPGYSPLEVEQRITYPVETVMAGLPGLQ 80   Pseudomonas aerug...
Q48815      1 MLEKIIRFSLKHRWFVLLFTLVIAILGVYNFQRLPIDAVPDITNVQVQINTQASGYSPFEVEQRITFPIELAMSGLPSLD 80   Legionella pneumo...
AAD11749    1 MIEWIIRRSVANRFLVMMGALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAK 80   Salmonella enteri...
P38054      1 MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAK 80   Escherichia coli ...
AAA21970    1 MIESILSGSVRYRWLVLFLTAVVAVIGAWQLNLLPIDVTPDITNKQVQINSVVPTMSPVEVEKRVTYPIETAIAGLNGVE 80   Cupriavidus metal...
Q44586     81 NMRSLSRNGFSQVTVIFKESSNLYFMRQQVTERLAQARPNLPAGVEPQMGPVSTGLGEVFHYSVEYEFpdgkGAKVKDGe 160  Achromobacter xyl...
P13511     81 QTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRIQEAKDNLPEGVVPAMGPISTGLGEIYLWTVEAEE----GARKADG- 155  Cupriavidus metal...
P94177     81 QTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRIQEAKDNLPEGVVPAMGPISTGLGEIYLWTVEAEE----GARKADG- 155  Alcaligenes sp. CT14
CAB56471   81 ETRSLSRPGISQVTVIFEEGTDIYFARQQVNERLSTAREQLPEDISPTLGPISTGLGEIYLWTVEAEE----GATKEDG- 155  Pseudomonas aerug...
Q48815     81 YTRSLSRYGLSQVTVVFKDGTNIYFARQLINERLQEVKDKLPPGVETTLGPISTGLGEIFMYTVTNKP----NVPIS--- 153  Legionella pneumo...
AAD11749   81 TVRGFSQFGDSYVYVIFEDGTDLYWARSRVLEYLNQVQGKLPAGVSSEIGPDATGVGWIFEYALVDRS------------ 148  Salmonella enteri...
P38054     81 TVRGFSQFGDSYVYVIFEDGTDPYWARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIYEYALVDRS------------ 148  Escherichia coli ...
AAA21970   81 STRSMSRNGFSQVTVIFKESANLYFMRHEVSERLAQARPNLPENVEPQMGPVSTGLGEVFHYSVEYQYpdgtGASIKDGe 160  Cupriavidus metal...
Q44586    161 pgwqsdgsfltergerltdRVSKLAYLRTVQDWIIRPQLRTTAGVADVDSLGGYVKQFVVEPDAAKMAAYGISFEELAQA 240  Achromobacter xyl...
P13511    156 -------------------TAYTPTDLREIQDWVVRPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTLTDVVNA 216  Cupriavidus metal...
P94177    156 -------------------TAYTPTDLREIQDWVVRPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTLTDVVNA 216  Alcaligenes sp. CT14
CAB56471  156 -------------------SAYTPTDLRTIQDWIIRPQLRNVKGVAEINTIGRYAKQFLIAPDPKKLAAYKLTLGDLQNA 216  Pseudomonas aerug...
Q48815    154 -------------------QHYNPTELRTIQDWIIKPQLRNVEGVAEVNTIGGYEKQFHITPDPSKLVRYRLSLNDVVEA 214  Legionella pneumo...
AAD11749  149 -------------------GKHDLSELRSLQDWFLKFELKTIPNVAEVASVGGVVKQYQIQVNPVKLSQYGISLPEVKQA 209  Salmonella enteri...
P38054    149 -------------------GKHDLADLRSLQDWFLKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSA 209  Escherichia coli ...
AAA21970  161 pgwqsdgsfltergerlddRVSRLAYLRTVQDWIIRPQLRTTPGVADVDSLGGYVKQFVVEPDTGKMAAYGVSYADLARA 240  Cupriavidus metal...
Q44586    241 LEDANLSVGANFIRRSGESYLVRADARIKSADEIARAVIAQRQ-GVPITVGQVANINVGGELRSGAASRNGY-ETVVGSA 318  Achromobacter xyl...
P13511    217 LNKNNDNVGAGYIERRGEQYLVRAPGQVASEDDIRNIIVGTAQ-GQPIRIRDIGDVEIGKELRTGAATENGK-EVVLGTV 294  Cupriavidus metal...
P94177    217 LNKNNDNVGAGYIERRGEQYLVRAPGQVASEDDIRNIIVGTAQ-GQPIRIRDIGDVEIGKELRTGAATENGK-EVVLGTV 294  Alcaligenes sp. CT14
CAB56471  217 VLRNNENVGAGYIERRGEQLLIRAPGQVKDMDDIRGIIVSNVD-GVPIRIRDVAEVGLGKELRTGRATENGR-EVVLGTV 294  Pseudomonas aerug...
Q48815    215 LERNNANVGAGYIETNGEQNLIRVPGQVQNMADIENIVIASFE-GTPVRIRDVAEVALGKELRTGAATENSK-EVVLGTV 292  Legionella pneumo...
AAD11749  210 LESSNQEAGGSSVEIAEAEYMVRASGYLQSIDDFNNIVLKTGEnGVPVYLRDVARVQTGPEMRRGIAELNGQgEVAGGVV 289  Salmonella enteri...
P38054    210 LDASNQEAGGSSIELAEAEYMVRASGYLQTLDDFNHIVLKASEnGVPVYLRDVAKVQIGPEMRRGIAELNGEgEVAGGVV 289  Escherichia coli ...
AAA21970  241 LEDTNLSVGANFIRRSGESYLVRADARIKSADEISRAVIAHG--KMSHHVGQVARVKIGGELRSGAASRNGN-ETVVGSA 317  Cupriavidus metal...
Q44586    319 LMLVGANSRTVAQAVGDKLEEIKKTLPPGVVIVPTLNRSQLVMATIKTVAKNLVEGAALVVVILFALLGNWRAAVIAALV 398  Achromobacter xyl...
P13511    295 FMLIGENSRAVSKAVDEKVASINRTMPEGVKIVTVYDRTRLVDKAIATVKKNLLEGAVLVIVILFLFLGNIRAALITATI 374  Cupriavidus metal...
P94177    295 FMLIGENSRAVSKAVDEKVASINRTMPEGVKIVTVYDRTRLVDKAIATVKKNLLEGAVLVIVILFLFLGNIRAALITATI 374  Alcaligenes sp. CT14
CAB56471  295 FMLIGENSREVAQAVGQRLEEINRTLPKGVKAITVYDRTTLVDKAVATVKKNLVEGAALVIAVLFLFLGNIRAALITATI 374  Pseudomonas aerug...
Q48815    293 FILMGENSRTVSERVAAKMKDINKTLPEGVEAITVYNRTTLVNATINTVKNNLLEGALLVCVILFLFLGNIRAALITAMV 372  Legionella pneumo...
AAD11749  290 ILRSGKNARDVITAVRDKLETLKASLPEGVEIVTTYDRSQLIDRAIDNLSSKLLEEFFVVAIVCALFLWHVRSALVAIIS 369  Salmonella enteri...
P38054    290 ILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKLLEEFIVVAVVCALFLWHVRSALVAIIS 369  Escherichia coli ...
AAA21970  318 LMLVGANSRTVAQAVGDKLEQISKTLPPGVVIVPTLNRSQLVIATIETVAKNLIEGALLVVAILFALLGNWRAATIAALV 397  Cupriavidus metal...
Q44586    399 IPLSLLISAIGMNGLNISGNLMSLG--ALDFGLIIDGAVIIVENSLRRLAERQHHE-GRLLTLKERLEEVILSSREMVRP 475  Achromobacter xyl...
P13511    375 IPLAMLFTFTGMVNYKISANLMSLG--ALDFGIIIDGAVVIVENCVRRLAHAQEHH-GRPLTRSERFHEVFAAAKEARRP 451  Cupriavidus metal...
P94177    375 IPLAMLFTFTGMVNYKISANLMSLG--ALDFGIIIDGAVVIVENCVRRLAHAQEHH-GRPLTRSERFHEVFAAAKEARRP 451  Alcaligenes sp. CT14
CAB56471  375 IPLSMLFTFTGMVGNRVSANLMSLG--ALDFGIIVDGAVVIVENAIRRLAHAQAHH-GRQLTRAERFHEVFAASREARRA 451  Pseudomonas aerug...
Q48815    373 IPLSMLLTITGMVENQISANLMSLG--ALDFGLIVDGAVIIVENCIKHLAEQQHAL-HRVLNLEERLKVISYATTEVIRP 449  Legionella pneumo...
AAD11749  370 LPLGLCIAFIVMHFQGLNANIMSLGgiAIAVGAMVDAAIVMIENAHKRLEEWDHRHpGEQIDNVTRWKVITDASVEVGPA 449  Salmonella enteri...
P38054    370 LPLGLCIAFIVMHFQGLNANIMSLGgiAIAVGAMVDAAIVMIENAHKRLEEWQHQHpDATLDNKTRWQVITDASVEVGPA 449  Escherichia coli ...
AAA21970  398 IPLSLLVSAIGMNQFHISGNLMSLG--ALDFGLIIDGAVIIVENSLRRLAERQHRE-GRLLTLDDRLQEVVQSSREMVRP 474  Cupriavidus metal...
Q44586    476 TVYGQLVIFMVFLPCLTFQGVEGKMFSPMVITLMLALASAFVLSLTFVPAMVAVLLRKKVS-EKEVRVIAVTKERYRPLL 554  Achromobacter xyl...
P13511    452 LIFGQLIIMIVYLPIFALTGVEGKMFHPMAFTVVLALLGAMILSVTFVPAAVALFIGERVA-EKENRLMLWAKRRYEPLL 530  Cupriavidus metal...
P94177    452 LIFGQLIIMIVYLPIFALTGVEGKMFHPMAFTVVLALLGAMILSVTFVPAAVALFIGERVA-EKENRLMLWAKRRYEPLL 530  Alcaligenes sp. CT14
CAB56471  452 LIFGQIIIMVVYLPIFALTGVEGKMFHPMAFTVVTALLGAMILSVTFVPAAIALFITGKVK-EEENFVMRRARLAYEPAL 530  Pseudomonas aerug...
Q48815    450 SIFGVFIITVVYLPILTLTGVEGKMFLPMAQTVIIALLASMLFALTFVPAAVAIFLRGHLQ-EKENWLVHYLSLGYAKVL 528  Legionella pneumo...
AAD11749  450 LFISLLIITLSFIPIFTLEGQEGRLFGPLAFTKTYSMAGAAALAIIVIPILMGFWIRGKIPaETSNPLNRVLIKAYHPLL 529  Salmonella enteri...
P38054    450 LFISLLIITLSFIPIFTLEGQEGRLFGPLAFTKTYAMAGAALLAIVVIPILMGYWIRGKIPpESSNPLNRFLIRVYHPLL 529  Escherichia coli ...
AAA21970  475 TVYGQLVIFMVFLPSLTFQGVEGKMFSPMVITLMLALASAFVLSLTFVPAMVAVMLRKKVA-ETEVRVIVATKESYRPWL 553  Cupriavidus metal...
Q44586    555 ERAVARPMPFLGAALVTLALAAMAFTFVGREFMPTLDEQNLNLSSVRIPSTSIDQSVAIDLPLERAVL-SLPEVQTVYSK 633  Achromobacter xyl...
P13511    531 EKSLANTAVVLTFAAVSIVLCVAIAARLGSEFIPNLNEGDIAIQALRIPGTSLSQSVEMQKTIETTLKaKFPEIERVFAR 610  Cupriavidus metal...
P94177    531 EKSLANTAVVLTFAAVSIVLCVAIAARLGSEFIPNLNEGDIAIQALRIPGTSLSQSVEMQKTIETTLKaKFPEIERVFAR 610  Alcaligenes sp. CT14
CAB56471  531 RWVLGHRALVVGGALGVILLTALVASRMGSEFIPSLSEGDFAMQGLRVPGTSLTQSVEMQQTLEKKLMgKFPEIDGFFAR 610  Pseudomonas aerug...
Q48815    529 RRCFHARRVVISAAVALVVVSLGIAFHLGGEFIPSLDEGDIAMHAMRIPGTSLTQAITMQDLVEKRIR-QFSEVKNVFAK 607  Legionella pneumo...
AAD11749  530 LRVLHWPKTTLLVAALSIFTVVWPLSQVGGEFLPKINEGDLLYMPSTLPGVSPAEAAALLQTTDKLIK-SVPEVASVFGK 608  Salmonella enteri...
P38054    530 LKVLHWPKTTLLVAALSVLTVLWPLNKVGGEFLPQINEGDLLYMPSTLPGISAAEAASMLQKTDKLIM-SVPEVARVFGK 608  Escherichia coli ...
AAA21970  554 EHAVARPMPFIGAGIATVAVATVAFTFVGREFMPTLDELNLNLSSVRIPSTSIDQSVAIDLPLERAVL-SLPEVQTVYSK 632  Cupriavidus metal...
Q44586    634 AGTASLAADPMPPNASDNYIILKPKSEWPEGITTKEQVIERIREKTAPMVSNNYDVTQPIQMRFNELIGGVRSDVAVKIY 713  Achromobacter xyl...
P13511    611 TGTAEIASDLMPPNISDGYIMLKPEKDWPEPKKTHAELLSAIQEEAGKIPGNNYEFSQPIQLRFNELISGVRSDVAVKIF 690  Cupriavidus metal...
P94177    611 TGTAEIASDPMPPNISDGYIMLKPEKDWPEPKKTHAELLSAIQEEAGKIPGNNYEFSQPIQLRFNELISGVRSDVAVKIF 690  Alcaligenes sp. CT14
CAB56471  611 TGTAEIASDLMPPNASDSYVMLKPQSQWPDPKKSREALLEELQAAALEVPGSVYEFSQPIQLRFNELISGVRSDVAVKVF 690  Pseudomonas aerug...
Q48815    608 LGTAEVATDPMPPNVADTFIILKSRKKWTNPKKTKPGLVQEIESAVQQIPGNNYEFTQPIQMRFNELISGVRSDVAVKVF 687  Legionella pneumo...
AAD11749  609 TGKAETATDSAPLEMVETTIQLKPEDQWRPG--MTIDKIIDELDRTVRLPGLANLWVPPIRNRIDMLSTGIKSPIGIKVS 686  Salmonella enteri...
P38054    609 TGKAETATDSAPLEMVETTIQLKPQEQWRPG--MTMDKIIEELDNTVRLPGLANLWVPPIRNRIDMLSTGIKSPIGIKVS 686  Escherichia coli ...
AAA21970  633 AGTASLAADPMPPNASDNYIILKPKSEWPEGVTTKEQVIERIREKTAPMVGNNYDVTQPIEMRFNELIGGVRSDVAVKVY 712  Cupriavidus metal...
Q44586    714 GENLDDLASTAQKIAAVLRKTPGATDTRVPLTGGFPTFDIVFDRAAIARYGLTVKEVADTVAAAMAGRPSGQIFDGDRRY 793  Achromobacter xyl...
P13511    691 GDDNNVLSETAKKVSAVLQGIPGAQEVKVEQTTGLPMLTVKIDREKAARYGLNMSDVQDAVATGVGGRDSGTFFQGDRRF 770  Cupriavidus metal...
P94177    691 GDDNNVLSETAKKVSAVLQGIPGAQEVKVEQTTGLPMLTVKIDREKAARYGLNMSDVQDAVATGVGGRDSGTFFQGDRRF 770  Alcaligenes sp. CT14
CAB56471  691 GDDMQVLNDTAEKISKVLQGIDGASEVKVEQTTGLPVLTVDIDRDKAARFGLNVGDIQDTVATALGGRNAGTLFEGDRRF 770  Pseudomonas aerug...
Q48815    688 GDDMDTLLKTAEAISAQLKQVPGAADVKVEQVSGLPLLTVEINRDVLARYGLQIGTVQEAVVIATGGKKGGELFEGDKRF 767  Legionella pneumo...
AAD11749  687 GTVLSDIDATAQSIEAVAKTVPGVVSVLAERLEGGRYIDIDINREKASRYGMTVGDVQLFVSSAIGGAMVGETVEGVARY 766  Salmonella enteri...
P38054    687 GTVLADIDAMAEQIEEVARTVPGVASALAERLEGGRYINVEINREKAARYGMTVADVQLFVTSAVGGAMVGETVEGIARY 766  Escherichia coli ...
AAA21970  713 GENLDELAATAQRIAAVLKKTPGATDVRVPLTSGFPTFDIVFDRAAIARYGLTVKEVADTISTAMAGRPAGQIFDGDRRF 792  Cupriavidus metal...
Q44586    794 DIVIRLPGQQRENLDVLGALPVMLPAVEGQPRASVPLRQLVQFRFTQGLNEVSRDNGKRRVYVEANVGGRDLGSFVDDAA 873  Achromobacter xyl...
P13511    771 DIVVRLPEAVRGEVEALRRLPIPLPKGVDARTTFIPLSEVATLEMAPGPNQISRENGKRRIVISANVRGRDIGSFVPEAE 850  Cupriavidus metal...
P94177    771 DIVVRLPEAVRGEVEALRRLPIPLPKGVDARTTFIPLSEVATLEMAPGPNQISRENGKRRIVISANVRGRDIGSFVPEAE 850  Alcaligenes sp. CT14
CAB56471  771 DIVIRLPETLRADLPALSNLLIPLPPNNLARIDFIPLSDVARLDLSPGPNQISRENGKRRIVVSANVRGRDIGSFVLEAQ 850  Pseudomonas aerug...
Q48815    768 DIVVRLPESLRSDPNVLRQIFIPLPLSKDGEQHFIPLSEVASLIRSESPNQISRENGKRRVVVTANVRNRDLSSFVSEAK 847  Legionella pneumo...
AAD11749  767 PINIRYPQDYRNSPQALKQMPILTP-----MKQQITLGDVADINVVSGPTMLKTENARPASWIYVDARGRDMVSVVNDIK 841  Salmonella enteri...
P38054    767 PINLRYPQSWRDSPQALRQLPILTP-----MKQQITLADVADIKVSTGPSMLKTENARPTSWIYIDARDRDMVSVVHDLQ 841  Escherichia coli ...
AAA21970  793 DIVIRLPGEQRENLDVLGALPVMLPLSEGQARASVPLRQLVQFRFTQGLNEVSRDNGKRRVYVEANVGGRDLGSFVDDAA 872  Cupriavidus metal...
Q44586    874 KRIAAEVKLPPGMYIEWGGQFQNLQAATQRLAIIVPLCFILIAATLYMAIGSAALTATVLTAVPLALAGGVFALVLRDIP 953  Achromobacter xyl...
P13511    851 AAIQSQVKIPAGYWMTWGGTFEQLQSATTRLQVVVPVALLLVFVLLFAMFNNIKDGLLVFTGIPFALTGGILALWIRGIP 930  Cupriavidus metal...
P94177    851 AAIQSQVKIPAGYWMTWGGTFEQLQSATTRLQVVVPVALLLVFVLLFAMFNNIKDGLLVFTGIPFALTGGILALWIRGIP 930  Alcaligenes sp. CT14
CAB56471  851 QKLQDGVKIPAGYWTTWGGQFEQLQSAAKRLQVVVPVALLLVFTLLFAMFNNVKDGLLVFTGIPFALTGGVLALWLRGIP 930  Pseudomonas aerug...
Q48815    848 KRIDGQVKLPSGYWITWGGQFEQLQSAYQRLQIVVPITLLGIFLLLFISFGKVRDALLVFTGIPLALTGGVFALWLRGIP 927  Legionella pneumo...
AAD11749  842 TAISEKVKLRPGTSVAFSGQFELLEHANKKLKLMVPMTVMIIFILLYLAFRRVDEALLILMSLPFALVGGIWFLYWQGFH 921  Salmonella enteri...
P38054    842 KAIAEKVQLKPGTSVAFSGQFELLERANHKLKLMVPMTLMIIFVLLYLAFRRVGEALLIISSVPFALVGGIWLLWWMGFH 921  Escherichia coli ...
AAA21970  873 ARIAKEVKLPPGMYIEWGGQFQNLQAATKRLAIIVPLCFILIAATLYMAIGSAALTATVLTASPLALAGGVFALLLRGIP 952  Cupriavidus metal...
Q44586    954 FSISASVGFIAVSGVAVLNGLVLISAIRKRLEDGAA-----------PNEAVIEGAMERVRPVLMTALVASLGFVPMAIA 1022 Achromobacter xyl...
P13511    931 MSITAAVGFIALCGVAVLNGLVMLSFIRSLREEGHS-----------LDSAVRVGALTRLRPVLMTALVASLGFVPMAIA 999  Cupriavidus metal...
P94177    931 MSITAAVGFIALCGVAVLNGLVMLSFIRSLREEGHS-----------LDSAVRVGALTRLRPVLMTALVASLGFVPMAIA 999  Alcaligenes sp. CT14
CAB56471  931 LSISAAVGFIALSGVAVLNGLVMISFIRNLLQEGRS-----------LDQAVWEGAITRLRPVLMTALVASLGFVPMALA 999  Pseudomonas aerug...
Q48815    928 LSISAGVGFIALSGVAVLNGLVMITFINKLREQKKVy----------LKDAVLQGSLARLRPVLMTALVASLGFVPMALA 997  Legionella pneumo...
AAD11749  922 MSVATGTGFIALAGVAAEFGVVMLMYLRHAIEAHPElsrketftpegLDEALYHGAVLRVRPKAMTVAVIIAGLLPILWG 1001 Salmonella enteri...
P38054    922 LSVATGTGFIALAGVAAEFGVVMLMYLRHAIEAVPSlnnpqtfseqkLDEALYHGAVLRVRPKAMTVAVIIAGLLPILWG 1001 Escherichia coli ...
AAA21970  953 FSISAAVGFIAVSGVAVLNGLVLISAIRKRLDDGMA-----------PDAAVIEGAMERVRPVLMTALVASLGFVPMAIA 1021 Cupriavidus metal...
Q44586   1023 TGTGAEVQKPLATVVIGGLITATVLTLFVLPAVCGMVLRRQKKLEKPg------GELLEA 1076 Achromobacter xylosoxidans
P13511   1000 TGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRLAHRKDEDAEDTrepvtqtHQPDQG 1059 Cupriavidus metallidurans CH34
P94177   1000 TGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRLAHRKDEDAEDTrepvtqtHQPDQG 1059 Alcaligenes sp. CT14
CAB56471 1000 TGTGAEVQRPLATVVIGGILSSTMLTLLVLPVLYRWTHGRDAGPREE--------TPAAG 1051 Pseudomonas aeruginosa
Q48815    998 TGTGSEVQRPLATVVIGGIISSTFLTLLVLPGLYYVFHGRRKKGQSK-------SEPQEQ 1050 Legionella pneumophila
AAD11749 1002 TGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYKLIWLRRHKKSVS------------- 1048 Salmonella enterica subsp. enterica s...
P38054   1002 TGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYKLMWLHRHRVRK-------------- 1047 Escherichia coli K-12
AAA21970 1022 TGTGAEVQKPLATVVIGGLVTATVLTLFVLPALCGIVLKRRTAGRPEa------QAALEA 1075 Cupriavidus metallidurans CH34
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap