Conserved Protein Domain Family
2A0307_GadC

?
TIGR00910: 2A0307_GadC 
glutamate:gamma-aminobutyrate antiporter
Lowered cutoffs from 1000/500 to 800/300, promoted from subfamily to equivalog, and put into a Genome Property DHH 9/1/2009 [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129988
View PSSM: TIGR00910
Aligned: 2 rows
Threshold Bit Score: 809.132
Threshold Setting Gi: 18202004
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD14843   8 GKAKQLTLLGFFAITASMVMAVYEYPTFATSGFSLVFFLLLGGILWFIPVGLCAAEMATVDGWEEGGVFAWVSNTLGPRW 87  Shigella flexneri
O30417     1 MNQKKLSLFGFFALTASMVLTVYEYPTFATSKLHLVFFLLLGGLLWFLPVALCAAEMATVEGWKNGGIFSWVSQTLGERF 80  Lactococcus lactis ...
AAD14843  88 GFAAISFGYLQIAIGFIPMLYFVLGALSYILKWPALNEDPITKTIAALIILWALALTQFGGTKYTARIAKVGFFAGILLP 167 Shigella flexneri
O30417    81 GFAAIFFQWFQITVGFVTMIYFILGALSYVLNFQALNTDPLIKFIGLLIIFWGLTFSQLGGTQRTAKLVKAGFVVGIVIP 160 Lactococcus lactis ...
AAD14843 168 AFILIALAAIYLHSGAPVAIEMDSKTFFPDFSKVGTLVVFVAFIGSYMGVEASATHVNEMSNPGRDYPLAMLLLMVAAIC 247 Shigella flexneri
O30417   161 SVILFGLAAAYFIGGNPIEIPINSHAFVPDFSQVSTLVVFVSFILAYMGVEASASHINELENPKRNYPLAMILLVILAIS 240 Lactococcus lactis ...
AAD14843 248 LSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSHVAPEIEWTVRVISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPA 327 Shigella flexneri
O30417   241 LDAIGGFSVAAVIPQKELSLSAGVIQTFQTLILHFNHHLGWLVKVIALMIAFGVMGEVSSWVVGPSRGMFAAAQRGLLPK 320 Lactococcus lactis ...
AAD14843 328 AFAKMNKNGVPVTLVISQLVITSIALIILTNTGGGNNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDLKRTFNIPG 407 Shigella flexneri
O30417   321 FLRKTNTHEVPVPLVMIQGIIVTLWGAVLTFGGGGNNLSFLVAISLTVVIYLVGYLLFFIVYFVLIYKKQNLKRTYNVPG 400 Lactococcus lactis ...
AAD14843 408 GKGVKLVVAIVGLLTSIMAFIVSFLPPDNIQGDSTDMYVELLVVSFLVVLALPFILYAVHDRKGKAntgvTLEPINSQNA 487 Shigella flexneri
O30417   401 KIIGKTIIAGIGFLLSIFALFISFVPPASIAKNETHTYQMILLISFVVTAILPFIIYELHDKKGHD----TIEEPTHFKA 476 Lactococcus lactis ...
AAD14843 488 PKGHFFLHPRARSPHYIVMNDK---KH 511 Shigella flexneri
O30417   477 GDVNPAIYPAARGEHHIIKKEEhilKH 503 Lactococcus lactis subsp. cremoris MG1363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap