Conserved Protein Domain Family
2A0306

?
TIGR00909: 2A0306 
amino acid transporter
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129987
View PSSM: TIGR00909
Aligned: 5 rows
Threshold Bit Score: 435.72
Threshold Setting Gi: 499178645
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB76881      46 LRRSLGLWQLTMISIGATLGTGIFVVLGEAVPKA-GPAVTLSFVIAGLTALFSALSYAELAGTIPVAGSSYSYAYATMGE 124 Streptomyces co...
WP_003245791  24 LKRELGAFDLTLLGIGAIIGTGIFVLTGTGAVTA-GPGLTISFVVAALACLFAALSYAEFASSVPVSGSVYTFTYATLGE 102 Bacillus subtilis
WP_004599391  21 LSKTLGAFDLILLGLGAMIGTGVFVVTGIIAAKFsGPAVMISYMIAGITCIFVALVYTELAAMLPTSGSIYTYSYVAFGE 100 Rickettsia prow...
WP_010879109   7 LSRDLSFFDITMIGIAGMIGAGVFALTGIAAGIA-GPAIILAFFLNGIIATLTGLAYAELGSAMPQAGGGYLWIKEAMGD 85  Archaeoglobus f...
WP_010876185   5 LRRELGLFDAVNLVVGTIVGADIYIVAAYGAGSL-GPASILAWLLAGLMALIIALVFSEASAMLPRTGGPYVYAGEALGR 83  Methanothermoba...
CAB76881     125 LVAWICGWCLVLEYGVSVAAVAVGWGEYLNELLDGtIGVTLPAALSAPPGDGG----IFNLPALIVVLLAMTFLLGGARE 200 Streptomyces co...
WP_003245791 103 LMAFIIGWDLILEYMLAVSAVSVGWSGYFQSFLSG-LGIHLPVALTAAPGAVKgtftLFNLPAFVIVMAITYLLYLGIKE 181 Bacillus subtilis
WP_004599391 101 VFAWMIGSVIILELGVSAGIVAAGWSGYVQGILEA-GGIYLPKVLTTVPSNGG----VINLPAFLISAFIGFILFLGTKD 175 Rickettsia prow...
WP_010879109  86 YAGFMAGWIDWAAHTIACALYAVTFGAFFAEMLVGfVGLPLPHVLTAK------------ISSLAMVSFLAYVNYRGAKE 153 Archaeoglobus f...
WP_010876185  84 FTGFITGWSLWVSSWVAIAVFPLAFIYYLEYFIP----LDPPAEAVIK---------------VLFILSLTIINIAGVGR 144 Methanothermoba...
CAB76881     201 SACANTIMVVVKIAALVLFCAIGVQGFRSG------NYEHFMPLGMAGVSAAGATLFFSYIGFDAASTAGEEAKNAQRDL 274 Streptomyces co...
WP_003245791 182 SKRVNNIMVILKILVVLLFIAVAAVYVKPH------NWQPFMPMGFGGVFSAAALVFFAFIGFDAVSSAAEETKNPAKDL 255 Bacillus subtilis
WP_004599391 176 SKKINAILVFIKMVAIFAFVLAAAPHFDAT------NWSNFMPFGFGSVVMGSSILFLAFTGFGTIATAAEECKNPKRDI 249 Rickettsia prow...
WP_010879109 154 SGFLGSLVTVLKVLILLVFAGFGIIKMLSYpdw-qsSFTPFFPTGFAGVLAAMGLTFIAFEGFEIIVQSGEEVKDPEKNI 232 Archaeoglobus f...
WP_010876185 145 AGKVNDILTILKVAPVLLFAVLGAIHLALNpgllvsNYTPAAPMGLGALGTVTVLVFWAYVGFELVTVPADEVRDPERTI 224 Methanothermoba...
CAB76881     275 PRAIMLSLVIVTVLYVLVAAVAVGA----KPWRTFTDSEASLAQIMT-DvTGQSFWGTLLAFCAVVAIASVVLTVLYGQT 349 Streptomyces co...
WP_003245791 256 PKGIIFSLLVCTILYVTVSAIMTGV----IPFAQFAGVDHPVSLVLQ-S-AGQNWVAGIIDIGAVLGMTTVMLVMLYGQT 329 Bacillus subtilis
WP_004599391 250 VIGIIGSLILTTLVYVIMSGLVTGI----APFDQLNNDRPLAYALTI-N--NSKIGSAIVSTGAVCGMMTVLMMNIYGTS 322 Rickettsia prow...
WP_010879109 233 PKAIVVSLWVAVAIYILIAFSLLGAvradVPSWMYLGQLAELSLVKVaD-SIMPLGGWMILAGGLISTISAMNATIYSSS 311 Archaeoglobus f...
WP_010876185 225 PLSITLGMIFVTLFYILTNAVILGL----VPWRVLASSTAPLTVAGY-S-LMGGIGALILTAGAVFSIAGSEEAGMLTTA 298 Methanothermoba...
CAB76881     350 RVLFAMSRDGLVPKVFSKVHPKTGAPRANTLIVSLFCGVLAAAVPLGQLADATSIGTLFAFALVNVAVVVLRRTRPEMRR 429 Streptomyces co...
WP_003245791 330 RVMFAMSRDGLVPGSLSKVHPKHKTPYVATWFFGTMSALLGSLVPLDELAKLVNIGTLSAFVLISVAVIVLRKKQPDLPR 409 Bacillus subtilis
WP_004599391 323 RIFYAIARDGLLPKSFAKLHPKYDSPYITIIIFSALAAFLGGFCPTEIITQLTSMGALIDYIAVAIIVMMFRIKLPTAQR 402 Rickettsia prow...
WP_010879109 312 RVIFALSRSGYLHRSLSAINERTKTPHY-AIFFSYIIIAAASLAPIEAVASAASLMFIILFLAVNVTLIILRLRRPDIQS 390 Archaeoglobus f...
WP_010876185 299 RLLFAMSEDGFLPGFLSRVHRRFGTPHMSILVQNLTALLAALTGTVSGLIELSVVTLLLPYAVTCISLAILRRRD----- 373 Methanothermoba...
CAB76881     430 TFRVPLSP------VLPALGFGLCVWMMGSLSTVTWVVFGVWMAVGLVFYFVY 476 Streptomyces coelicolor A3(2)
WP_003245791 410 AFKCPGVP------VIPGLAILFCLFLILNLGWVTIVRFLVWLLIGLVIYFLY 456 Bacillus subtilis
WP_004599391 403 AFKCPIVF------IIAPFILFACIYLLLTQMYGDEIYKGNFNLLTSGRVLIY 449 Rickettsia prowazekii
WP_010879109 391 AFRLPLVPvlpaiaAALLAVVSYFLITQVEHGEGVFLITIAWMFLGSFFYFAY 443 Archaeoglobus fulgidus
WP_010876185 374 GSGIPLKS------VLGVLV---CIYLLMNTTPSTTAWGLLLILSGAPLYLIF 417 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap