Conserved Protein Domain Family
2A0305

?
TIGR00908: 2A0305 
ethanolamine permease
The three genes used as the seed for this model (from Burkholderia pseudomallei, Pseudomonas aeruginosa and Clostridium acetobutylicum are all adjacent to genes for the catabolism of ethanolamine. Most if not all of the hits to this model have a similar arrangement of genes. This group is a member of the Amino Acid-Polyamine-Organocation (APC) Superfamily. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129986
View PSSM: TIGR00908
Aligned: 3 rows
Threshold Bit Score: 613.001
Threshold Setting Gi: 52211396
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAH37386      16 ARPALQQTLGTWQLW-GIAVGLVISGEYFGWSYGWASAGTLGFVVTALFVAAMYTTFIFSFTELTTSIPHAGGPFAYARR 94  Burkholderia ps...
WP_023081562  26 QHRQLKKGAAGWVLLvGLGVAYVISGDYAGWNFGLAQGGWGGMFLATLLMATMYLCMCFSLAELSSMIPTAGGGYGFARS 105 Pseudomonas aer...
WP_010966006   1 MAKELKKTLSTFQLW-AIIVGMVISGMYCGWNNALTFTSPMGFVVATLIVTVFYGTFMFSYAELATAMPKADGSSEFASR 79  Clostridium ace...
CAH37386      95 AFGPAGGYLAGVATLVEFVFAPPAIALAIGAYLHVQFPGLePKHAAMGAYLVFMALNIVGVQIAATFELVVTLLAIFELL 174 Burkholderia ps...
WP_023081562 106 AFGPWGGFLTGTAILIEYAIAPAAIACFIGAYCESLFGVG-GWLIYLVFYIVFIGIHILGAGEALKLMFVITAVAAIALG 184 Pseudomonas aer...
WP_010966006  80 TMGRLGGFFAGFSCILEFLFATPAIAISIGAYVNFIIPSVpVTVAALVFYALFVIVNCFGVKTAAIIETVVTIVAIIGLI 159 Clostridium ace...
CAH37386     175 VFMGVVSPGFAWSNFVKGGWA---GADHFSAGAFHGMFAAIPFAIWFFLAIEGVAMAAEEAKHPKRSIPIAYVAGILTLV 251 Burkholderia ps...
WP_023081562 185 VFIVAMVPHFDSANLFNIPQTaatGASSFLPFGYVGVWAAIPYAIWFFLAVEGVPLAAEETKNPKRDLPRGLIGAMLVLL 264 Pseudomonas aer...
WP_010966006 160 IFAGASATHIDPIKIFGG--------NIYKGGAT-GIFNAIPFAIWFYLAAEGGAMSAEECKNPKKDISKGFIIAIITLM 230 Clostridium ace...
CAH37386     252 ALAIGVMVFAGGAGDWTKLANINDPLPQAMKYIVGANSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALAREGYLPEWL 331 Burkholderia ps...
WP_023081562 265 AFAALILVVGPGAAGAKELMGSGNPLVEALESAYKGSTWMSQFVNLVGLAGLIASFFSIIYAYSRQIFALSRAGYLPRSL 344 Pseudomonas aer...
WP_010966006 231 VLALGTFLCTAGVLDNKTLGITNSPIPDTLNVIFGKGNFLSKFMSFIGLFGLIASLHGIIIGYSRQVFAMSRSKYLPEFL 310 Clostridium ace...
CAH37386     332 AKVHpRFKTPYRAILAGGVVGIAAIYSDEliqfggqtlTANIVTMSVFGAIVMYIVSMAALFKLRRMQPRMERPFRAPLY 411 Burkholderia ps...
WP_023081562 345 SLTN-RKKAPVLALVVPGVIGFGLSLTGQ---------GDLLILVAVFGATISYVLMMAAHITLRIRRPDMQRPYRTPGG 414 Pseudomonas aer...
WP_010966006 311 SKVN-SKGSPVPAIVVPSLIGMIFVLTNN---------TATIIVISSFGAIALHAISMIAFFLLRKKEPKLERPYKVS-- 378 Clostridium ace...
CAH37386     412 PFFPAFALVAALVCLGTMVYFNA-LVASIFVAFVALGYGYFLATRAQREAAPADAL 466 Burkholderia pseudomallei K96243
WP_023081562 415 ILTSGVALALACVAVVAGFLVDPrVVVGAVAIYAVLIGYFALYSRHHLVSGTPEEE 470 Pseudomonas aeruginosa
WP_010966006 379 IILPIIALVLNAVFLITTIYSSMsTISWVILSFVLAFVYYFVYSKLNSKKDIEEEQ 434 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap