Conserved Protein Domain Family
2A0302

?
TIGR00905: 2A0302 
transporter, basic amino acid/polyamine antiporter (APA) family
This family includes several families of antiporters that, rather commonly, are encoded next to decarboxylases that convert one of the antiporter substrates into the other. This arrangement allows a cycle that can remove proteins from the cytoplasm and thereby protect against acidic conditions. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129983
View PSSM: TIGR00905
Aligned: 10 rows
Threshold Bit Score: 445.656
Threshold Setting Gi: 115415
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P18275         1 MSQES-----------SQKLRLGALTALVVGSMIGGGIFSLPQNMAASADVGAVLIGWAITAVGMLTLAFVFQTLANRKP 69  Pseudomonas aer...
CAA66366       1 MAEQHn---------ePKKLGFAQLAALIVGSMIGGGAFNLPSDMARGAGTGAVIIGWIITGIGMIALAFVYQSLANRKP 71  Clostridium per...
CAA76779       1 MAEE-------------KKLGLFALIALVIGSMIGGGAFNLASDMASGAGAGAILIGWIITGVGMIALAFSFQNLTTKRP 67  Bacillus lichen...
P77429         1 MEKK---------------LGLSALTALVLSSMLGAGVFSLPQNMAAVASPAALLIGWGITGAGILLLAFAMLILTRIRP 65  Escherichia coli
O53092         1 MTEEKp----------AKKIGLLALIALVISSSIGSGVFGLTSDLASASAPGPVLIAWVIVGFGILMLALSLNNLLMKEP 70  Lactobacillus s...
P35865         1 MNTQSdsagsqgaaatSRTVSIRTLIALIIGSTVGAGIFSIPQNIGSVAGPGAMLIGWLIAGVGMLSVAFVFHVLARRKP 80  Corynebacterium...
P24170         1 MSQAK-----------SNKMGVVQLTILTMVNMMGSGIIMLPTKLAEVG--TISIISWLVTAVGSMALAWAFAKCG-MFS 66  Escherichia coli
P44768         1 MS-AK-----------SNKIGVVQLTILTMVNMMGSGIIMLPTKLAEIG--TISIVSWLVTAVGSTALAYAFAQCG-MFS 65  Haemophilus inf...
P23891         1 MSSAK-------------KIGLFACTGVVAGNMMGSGIALLPANLASIG--GIAIWGWIISIIGAMSLAYVYARLATKNP 65  Escherichia coli
WP_010883664   1 MTSRTk---------sSKNLGTIALAGMVVSSIIGGGIFSLPQNMAATAGAGAVILSWILTGFGMFFIANTFRILSTIRP 71  Chlamydia pneum...
P18275        70 ELDGGVYAYAkAGFGDYMGFSSAWGYWISAWLGNVGYFVLLFSTLGYFFP-----IFGKGDTVAAIVCASVLLWALHFLV 144 Pseudomonas aer...
CAA66366      72 ELTGGVYSYA-KGFGEYIGFNSAWGYWLSAWIGNVSYSVLLFGAVGYFLP-----MFGAGNNVASIIGASVLLWAFTLLI 145 Clostridium per...
CAA76779      68 DLDGGIFTYArEGFGHFMGFNSGWGYWFAALLGNVAYGTLLFSAIGYFIP-----AFGDGQNIASIIGASVILWCVHFLI 142 Bacillus lichen...
P77429        66 ELDGGIFTYArEGFGELIGFCSAWGYWLCAVIANVSYLVIVFSALSFFTDtpelrLFGDGNTWQSIVGASALLWIVHFLI 145 Escherichia coli
O53092        71 ELEG-IFSYAeKGFGPFAGFISGWGYWLSAWLGNVTFATILMSALGYFFP-----IFKSRQNLPSILVASVLSWSLTYFV 144 Lactobacillus s...
P35865        81 HLDSGVYAYArVGLGDYVGFSSAWGYWLGSVIAQVGYATLFFSTLGHYVP-----LFSQDHPFVSALAVSALTWLVFGVV 155 Corynebacterium...
P24170        67 RKSGGMGGYAeYAFGKSGNFMANYTYGVSLLIANVAIAISAVGYGTELLG-------ASLSPVQIGLATIGVLWICTVAN 139 Escherichia coli
P44768        66 KKSGGMGGYAeYSFGKAGNFMANYTYGVSLVIANTAIAISAVGYGSELFG-------TILSPLSIALWTIFTLWLATVLN 138 Haemophilus inf...
P23891        66 Q-QGGPIAYAg-EISPAFGFQTGVLYYHANWIGNLAIGITAVSYLSTFFP-------VLNDPVPAGIACIAIVWVFTFVN 136 Escherichia coli
WP_010883664  72 DLKEGIYMYSrEGFGPYIGFTIGWGYWLCQIFGNVGYAVITMDALNYFFPp----YFQGGNTLPAILGGSILIWVFNFIV 147 Chlamydia pneum...
P18275       145 LRGIKEAAFINTVTTVAKVVPLFLFILICLFA-FKLDIFTADIWGKsNp----DLGS-VMNQVRNMMLVTVWVFIGIEGA 218 Pseudomonas aer...
CAA66366     146 LNGVSGAALINLITTIAKLVPIFLFIVISLFM-FNFDKFTFQFWGT-S-----DLGG-IVTQVKSTMLVTLWCFIGIEGA 217 Clostridium per...
CAA76779     143 LRGVQSAAMINLITTISKLVPIFAFIIAIIFV-FHLDLFTNDFWGKgL-----SLGS-IGTQVKSTMLVTVWVFTGIEGA 215 Bacillus lichen...
P77429       146 LRGVQTAASINLVATLAKLLPLGLFVVLAMMM-FKLDTFKLDFTGL-------ALGVpVWEQVKNTMLITLWVFIGVEGA 217 Escherichia coli
O53092       145 NRGVEGAAAINTLVTICKLIPLFVFIIFGIVL-FKGHLFTQAFWNNmSs---sFVAGdVMSQIKNCMMVMMWVFVGIEGA 220 Lactobacillus s...
P35865       156 SRGISQAAFLTTVTTVAKILPLLCFIILVAFLgFSWEKFTVDLWARdG-----GVGS-IFDQVRGIMVYTVWVFIGIEGA 229 Corynebacterium...
P24170       140 FGGARITGQISSITVWGVIIPVVGLCIIGWFW-FSPTLYVDSWNPHhAp---------FFSAVGSSIAMTLWAFLGLESA 209 Escherichia coli
P44768       139 FGGARITGNISSFTIWGVIIPVVGISIIGWKW-FDGSMYVNSWNPHnVp---------TFEAIGVSISMTLWAFLGLESA 208 Haemophilus inf...
P23891       137 MLGGTWVSRLTTIGLVLVLIPVVMTAIVGWHW-FDAATYAANWNTAdTt---------DGHAIIKSILLCLWAFVGVESA 206 Escherichia coli
WP_010883664 148 LKGIRQASIINVIGTIFKIIPLIIFIILTAFF-FKLAVFKTDFWGHaVtkaqpSLGS-VSSQLKGTMLVTLWAFIGIEGA 225 Chlamydia pneum...
P18275       219 SIFSsRAEK-RSDVGKATVIGFITVLLLLVLVNVLSMGVMTQPELAKLQNPSMALVLEHVVGHWGAVLISVGLLISLLGA 297 Pseudomonas aer...
CAA66366     218 VVSG-RAKK-QSDVGKATVLGLIGTLIIYMLITLMALGVMDRVKLSGLENPSMAYVLEFAVGKWGAVLINLGLIISLFGS 295 Clostridium per...
CAA76779     216 VLFSsRAKK-SSDVGKATVIGLISVLVIYVMITMLSLGVMNQQNLAELPNPSMAAIMEHIVGKWGAVLINLGLIISVLGA 294 Bacillus lichen...
P77429       218 VVVSaRARN-KRDVGKATLLAVLSALGVYLLVTLLSLGVVARPELAEIRNPSMAGLMVEMMGPWGEIIIAAGLIVSVCGA 296 Escherichia coli
O53092       221 SMLSaRAEK-KSDAGKATILGLVSLLAIYILASVLPYGYLTQDQLASIKQPAMLYIFEQMVGTWGGYFIGVGLIISILGA 299 Lactobacillus s...
P35865       230 SVYSrQARS-RSDVSRATVIGFVAVLLLLVSISSLSFGVLTQQELAALPDNSMASVLEAVVGPWGAALISLGLCLSVLGA 308 Corynebacterium...
P24170       210 CANTdVVENpERNVPIAVLGGTLGAAVIYIVSTNVIAGIVPNMELANSTAPFGLAFAQMFTPEVGKVIMAL-MVMSCCGS 288 Escherichia coli
P44768       209 CANAdAVENpEKNVPIAVLGGTLGAAVIYIVSTNVIAGIVPNLELANSTAPFGLAFAHMFDETVGKVIMGL-MVMSCFGS 287 Haemophilus inf...
P23891       207 AVSTgMVKNpKRTVPLATMLGTGLAGIVYIAATQVLSGMYPSSVMAASGAP-FAISASTILGNWAAPLVSAFTAFACLTS 285 Escherichia coli
WP_010883664 226 VVMSgRAKN-PLSVGQATVLGFLGCLTIYILFSLLPFGSLFQHQLANIPNPSTAGVLDILVGKWGEVLMNVGLIIAVLSS 304 Chlamydia pneum...
P18275       298 LLSWVLLCAEIMFAAAKDHTMPEFLRRENANQVPANALWLTNICVQVFLVVVFFTsgd-pdgMDPYTKMLLLATSMILIP 376 Pseudomonas aer...
CAA66366     296 LLGWALLAAEIPYVAAKDGVLPKVFAKLNKKGTPSGSLIITNLLVQAFLILTLVV-------SSTYQALYSVASTAILVP 368 Clostridium per...
CAA76779     295 WLAWTLFAGELPLIAAREGVFPKWFGKENKNGAPTNALTLTNAIIQLFLLTFLIS-------DAAYQFAFSLASSAILIP 367 Bacillus lichen...
P77429       297 YLSWTIMAAEVPFLAATHKAFPRIFARQNAQAAPSASLWLTNICVQICLVLIWLT-------GSDYNTLLTIASEMILVP 369 Escherichia coli
O53092       300 WLSWTMLPAETMLLMAKQNLLPAYFGRVNKKKAPTFALVVTAGLIQVFLFTLLFT-------TKAYNFAYSLCTASIIVC 372 Lactobacillus s...
P35865       309 YVSWQMLCAEPLALMAMDGLIPSKIGAINSRGAAWMAQLISTIVIQIFIIIFFLN-------ETTYVSMVQLATNLYLVP 381 Corynebacterium...
P24170       289 LLGWQFTIAQVFKSSSDEGYFPKIFSRVTKVDAPVQGMLTIVIIQSGLALMTISPs-----lNSQFNVLVNLAVVTNIIP 363 Escherichia coli
P44768       288 LLGWQFTIAQVFKSSAEEGYFPAFFKKITSKDAPVVGMITITALQTLLSLMTISPs-----lNKQFNVLVDLAVVTNVIP 362 Haemophilus inf...
P23891       286 LGSWMMLVGQAGVRAANDGNFPKVYGEVDSNGIPKKGLLLAAVKMTALMILITLMnsaggkaSDLFGELTGIAVLLTMLP 365 Escherichia coli
WP_010883664 305 WLSWTIIVAEIPFSAAKNGTFPEIFTIENKEKSPSVSLYITSSVMQLAMLLVYFS-------SNAWNTMLSITGVMVLPA 377 Chlamydia pneum...
P18275       377 YFWSAAYGLLLTLKGe---------TYENd-----aRERSKDLVIAGIAVAYAVWLLYAGGLKYLLLSALLYAPGAILFA 442 Pseudomonas aer...
CAA66366     369 YLLSAMYGFKLALTGe---------TYDKn-----pTGRTRDKIFGGIATVYAIWLCYAAELKYLLLCFILYAVGIIFFY 434 Clostridium per...
CAA76779     368 YLFSGLYQLKYSWL-------------HKe-----pN-RGKNLIIGIIASIYGVWLVYAAGLDYLLLTMILYAPGILVFR 428 Bacillus lichen...
P77429       370 YFLVGAFLLKIATR-------------------------PLHKAVGVGACIYGLWLLYASGPMHLLLSVVLYAPGLLVFL 424 Escherichia coli
O53092       373 YMLVAAYQIKYSWAH-----------LQE-------KGNRQQLLIGVLALLFEIAGILMAGVSYLLLCFIAYIPGIYFYG 434 Lactobacillus s...
P35865       382 YLFSAFYLVMLATRGkgithphagtRFDDsgpeisrRENRKHLIVGLVATVYSVWLFYAAEPQFVLFGAMAMLPGLIPYV 461 Corynebacterium...
P24170       364 YILSMAALVIIQKVAn---------VPPS--------KAKVANFVAFVGAMYSFYALYSSGEEAMLYGSIVTFLGWTLYG 426 Escherichia coli
P44768       363 YLLSMAALAVLLKAEn---------VAPQ--------KYKTTVFVAFIGSLYSIYALYAAGEQAMLYGSIVTFIGWTLYG 425 Haemophilus inf...
P23891       366 YFYSCVDLIRFEGVN---------------------IRNFVSLICSVLGCVFCFIALMGASSFELAGTFIVSLIILMFYA 424 Escherichia coli
WP_010883664 378 YLASAAFLFKLSKSK----------TYPKkg----sIKAPLAMITGILGVVYSLWLIYAGGLKYLFMALVLLALGIPFYI 443 Chlamydia pneum...
P18275       443 KAKHEVGQ--PIFTGIEKLIFAAVVIGALVAAYGLYDGFLTL 482 Pseudomonas aeruginosa PAO1
CAA66366     435 IGKKQNNKdaEVFVGKEKILAIIVLVIAIIAIVMLFNGTITI 476 Clostridium perfringens
CAA76779     429 AVRK--GKegPVFNKAELLIAALILVLAVIAVIRLASGSISI 468 Bacillus licheniformis
P77429       425 YARKTHTHd-NVLNRQEMVLIGMLLIASVPATWMLVG----- 460 Escherichia coli
O53092       435 RARKNNGHq-HFLSKGEWLITTIIVIGAIIGIWLVVSGKIVI 475 Lactobacillus sakei
P35865       462 WTRIYRGE--QVFNRFEIGVVVVLVVAASAGVIGLVNGSLSL 501 Corynebacterium glutamicum ATCC 13032
P24170       427 LVSP---R--FELKNKHG------------------------ 439 Escherichia coli
P44768       426 FVSY---K--FDLKK--------------------------- 435 Haemophilus influenzae Rd KW20
P23891       425 RKMHERQS--HSMDNHTASNAH-------------------- 444 Escherichia coli
WP_010883664 444 DAGKKKKNakTFFAKKEIVGMTFIGLLALTAIFLFLTGRIKI 485 Chlamydia pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap