Conserved Protein Domain Family
mreB

?
TIGR00904: mreB 
cell shape determining protein, MreB/Mrl family
MreB (mecillinam resistance) in E. coli (also called envB) and the paralogous pair MreB and Mrl of Bacillus subtilis have all been shown to help determine cell shape. This protein is present in a wide variety of bacteria, including spirochetes, but is missing from the Mycoplasmas and from Gram-positive cocci. Most completed bacterial genomes have a single member of this family. In some species it is an essential gene. A close homolog is found in the Archaeon Methanobacterium thermoautotrophicum, and a more distant homolog in Archaeoglobus fulgidus. The family is related to cell division protein FtsA and heat shock protein DnaK. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
Statistics
?
PSSM-Id: 129982
View PSSM: TIGR00904
Aligned: 9 rows
Threshold Bit Score: 533.91
Threshold Setting Gi: 499182972
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC21715      37 FSNDLSIDLGTANTLIYVKRQGIVLDEPSVVAIRQDR-VGTLKSIAAVGKEAKLMLGRTPKSIVAIRPMKDGVIADFFVT 115 Haemophilus inf...
WP_001575055  34 FSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDR-AGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVT 112 Enterobacteriaceae
WP_010229321  32 FSGNVGIDLGTANTLVYVRGRGIVLSEPSVVAV-----DAQTHAVLAVGHKAKAMLGKTPRKIVAVRPMKDGVIADFEIA 106 Chlamydia murid...
WP_004596966   9 FSSGMAIDLGTANTIVYQKSRGIVLREPSVIALIKKD-GAFVP--YAYGHEAKMMLGRTPTDIEAKRPLKDGVIADFKGA 85  Rickettsia prow...
WP_002557301   7 FLIDIGIDLGTCNTLVYIKDYGVVMSEPSVVAIDITK-G---NKVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENT 82  Borrelia burgdo...
WP_010881946   7 FSADVGIDLGTCNTIIYVEGRGIVVNEPSVVAVERG-----TKSVVAVGSDAKRMLWKTPGNIVAIRPLKDGVIADMDTT 81  Treponema pallidum
AAA22397       5 GARDLGIDLGTANTLVFVKGKGIVVREPSVVALQTD-----TKSIVAVGNDAKNMIGRTPGNVVALRPMKDGVIADYETT 79  Bacillus subtilis
WP_000577765  10 FSHDIAIDLGTANTIVLVKGQGIIINEPSIVAVRMGLfDSKAYDILAVGSEAKEMLGKTPNSIRAIRPMKDGVIADYDIT 89  Helicobacter py...
WP_010880512  10 FSSNIGIDLGTANTAVFVEGKGIVLYEPSIVAIDTK-----SKKILAVGKEAKEMVGKTPENIQAIRPLRHGVISDFEVT 84  Aquifex aeolicus
AAC21715     116 EKMLQYFIKQVHSG-N-FM--RPspR--VLVCVPAGATQVERRAIKESAIGAGAREVYLIEEPMAAAIGAKLPVSTAVGS 189 Haemophilus inf...
WP_001575055 113 EKMLQHFIKQVHSN-S-FM--RPspR--VLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGS 186 Enterobacteriaceae
WP_010229321 107 EGMLKALIKRVTPArS-MF--RP--K--ILIAVPSGITGVEKRAVEDSALHAGAQEVILIEEPMAAAIGVDLPVHEPAAS 179 Chlamydia murid...
WP_004596966  86 EEMIKYFIKMVHNRrS-FF--GP--T--IVICVPSGSTPVERRAIQEAAESAGGRDVYLIEEPMAAAIGAGLPVTEATGS 158 Rickettsia prow...
WP_002557301  83 EKMIKYFINQIFSRkKlFF--KP--R--MVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGH 156 Borrelia burgdo...
WP_010881946  82 EKMIRYFISKILPRhR-LI--KP--R--MVIGIPSCITDVECRAVHESASKAGAGEVEVLEESLAAAIGANIPIEEPAGN 154 Treponema pallidum
AAA22397      80 ATMMKYYINQAIKNkG-MFtrKP--Y--VMVCVPSGITAVEERAVIDATRQAGARDAYPIEEPFAAAIGANLPVWEPTGS 154 Bacillus subtilis
WP_000577765  90 AKMIRYFIEKVHKRkT-WI--RP--R--IMVCVPYGLTSVERNAVKESTLSAGAREVFLIEEPMAAAIGAGLPVKEPQGS 162 Helicobacter py...
WP_010880512  85 QAMLTYFIKKVLGR-S-IL--KP--KpiTVIGVPTGITPVEKRAVVDAAKSAGAREVYLVAEPMAAAIGAGLPVEEPIGN 158 Aquifex aeolicus
AAC21715     190 MVIDIGGGTTEVAVISLNGIVYSSSVRIGGDRFDEAIISYVRRTFGSVIGEPTAERIKQEIGSAYIq-eGDEIKEMEVHG 268 Haemophilus inf...
WP_001575055 187 MVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEIGSAYP---GDEVREIEVRG 263 Enterobacteriaceae
WP_010229321 180 MIIDIGGGTTEIAIISLGGIVESRSLRIAGDEFDECIINYMRRTYNLMIGPRTAEEIKITIGSAYPl--GDQELEMEVRG 257 Chlamydia murid...
WP_004596966 159 MIVDIGGGTTEVAVLSLGGIVYARSVRVGGDKMDEAIISYIRRHYNLLIGEATAEKIKQEIGTAYVd-eNAEPRKMEIKG 237 Rickettsia prow...
WP_002557301 157 MVCDIGGGTTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNSHNIIIGQQTAEKLKIKIGNVYPdiqNLRVEKIDIKG 236 Borrelia burgdo...
WP_010881946 155 MVCDIGGGTTEVSVISLLGMVVTNAIRVGGDEFDQAIIKHVRSVHNLIIGEQTAERLKIEIGNASPe-kN--IEKVEVKG 231 Treponema pallidum
AAA22397     155 MVVDIGGGTTEVAIISLGGIVTSQSIRVAGDEMDDAIINYIRKTYNLMIGDRTAEAIKMEIGSAEAp---EESDNMEIRG 231 Bacillus subtilis
WP_000577765 163 LIVDIGGGTTEIGVISLGGLVISKSIRVAGDKLDQSIVEYIRKKFNLLIGERTGEEIKIEIGCAIKl---DPPLTMEVSG 239 Helicobacter py...
WP_010880512 159 MIVDIGGGTTDIAVISLAGIVVSNSLRVAGDEMNEAIIQYIKRKLHLLIGEQTAERIKIELGSAIMe---EEERQMEIRG 235 Aquifex aeolicus
AAC21715     269 HNLAEGAPRSFTLTSRDVLEAIQQPLNGIVAAVRTALEECQPEHAADIFERGMVLTGGGALLRNIDILLSKESGVPVIIA 348 Haemophilus inf...
WP_001575055 264 RNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVA 343 Enterobacteriaceae
WP_010229321 258 RDQVAGLPITKRINSVEIRECLAEPIQQIIECVRLTLEKCPPELSADLVERGMVLAGGGALIKGLDKALSKNTGLSVITA 337 Chlamydia murid...
WP_004596966 238 RDLIYGIPKEMILNERQIADSLIEPVSQIVEAVKVALEATPPELSSDIVDKGIVLTGGGSLLRNLDFVLSEATKLPVIVA 317 Rickettsia prow...
WP_002557301 237 TDAVTGLPRKQLVDSMEVRESLQEPINVVVDEVKRTLGATPPELATDIVERGIILTGGGALLKGLNRLLSKETGVPVYVA 316 Borrelia burgdo...
WP_010881946 232 TDAITGLPRRLEIDSVEVREALKEPITQIVEEIKRTLARTPPELAADIVERGIVMTGGGSLLKGLPKLISKETHVPVILA 311 Treponema pallidum
AAA22397     232 RDLLTGLPKTIEITGKEISNALRDTVSTIVEAVKSTLEKTPPELAADIMDRGIVLTGGGALLRNLDKVISEETKMPVLIA 311 Bacillus subtilis
WP_000577765 240 RDQVSGLLHTIELSSDDVFEAIKDQVREISSALRSVLEEVKPDLAKDIVQNGVVLTGGGALIKGLDKYLSDMVKLPVYVG 319 Helicobacter py...
WP_010880512 236 RD-MTGLPRTETITNHMVTEALEETVNSIVNAVRTTLEKTPPELASDIAERGIVLAGGGSLLRNLDKKIEQETGIKARYA 314 Aquifex aeolicus
AAC21715     349 EDPLTCVARGGGEALEMIDMHGG 371 Haemophilus influenzae Rd KW20
WP_001575055 344 EDPLTCVARGGGKALEMIDMHGG 366 Enterobacteriaceae
WP_010229321 338 PHPLLAVCLGTGKALEHLDQLKK 360 Chlamydia muridarum
WP_004596966 318 DDALSCVALGTGKVLEDFTKLKH 340 Rickettsia prowazekii
WP_002557301 317 DNPLLSVAVGAGLFYDYANRIDI 339 Borrelia burgdorferi group
WP_010881946 312 ENPMNCVAIGAGRYHEVYKDISG 334 Treponema pallidum
AAA22397     312 EDPLDCVAIGTGKALEHIHLFKG 334 Bacillus subtilis
WP_000577765 320 DEPLLAVAKGTGEAIQDLDLLSR 342 Helicobacter pylori
WP_010880512 315 DEPLTSVAKGLGMVLENIDLIRR 337 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap