Conserved Protein Domain Family
2A0129

?
TIGR00903: 2A0129 
major facilitator 4 family protein
This family of proteins are uncharacterized proteins from archaea. This family includes proteins from Archaeoglobus fulgidus and Aeropyrum pernix. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 129981
View PSSM: TIGR00903
Aligned: 2 rows
Threshold Bit Score: 491.764
Threshold Setting Gi: 499168625
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010866901  15 FSSQAIWVTYSPVTSLVAEDLDVSKEEVGLLAIVYPAAFLALTIPSGVLLDRAFRTWLTVGVLLTGAAGVLRLLDpLSYE 94  Aeropyrum pernix
WP_010879783  17 FASQAVWVTFSPVLTLVSEEINVSVELLGLLAVTYPIFFLILTIPSGLLLDRDFKRWFLFGSVATFFAAAGRLVS-FNYY 95  Archaeoglobus f...
WP_010866901  95 WLLACQVLAALGQPLLLNSFAPAASTIRPERRDTVVSLLSFAMYLGIIYALGTGYYIYTRLGLQWLNIPIAAVSAASVIL 174 Aeropyrum pernix
WP_010879783  96 WLLVCQLSGALGQPFLLNAFVPYASQLYEERRTLVISVLSLSMYLGTVFALAAGLKLYTAGGLTLLILPSAVVATAGIVL 175 Archaeoglobus f...
WP_010866901 175 YVAGLPALPQQAGSGLgfkdVVSEFRLLAGRRDLWLLGLILGLGVALFDNMSIWLEAALSPKGLGDIAGSSVALALLAGL 254 Aeropyrum pernix
WP_010879783 176 VLIAVRAVRFTKAESF----AVKQFGAVLKRKDLWIIGAILGFGVATFDNLATWLQPALRSAGLEKVAGDAVALAIVLGL 251 Archaeoglobus f...
WP_010866901 255 VGVAVIPPRVVRVGLRSWYIRAAALLVAVLYLALALETSRLAVQTLIPLAGLVMLPAYPVIMEWISTYYDKRLQGKAAGA 334 Aeropyrum pernix
WP_010879783 252 IGVAVIPDRVARANLRTIYMRSITPLIAAFFVILAFSLNTTLLFAFLGISGLLMLPAYAIIMDWIGKFCDREVHGSATGF 331 Archaeoglobus f...
WP_010866901 335 IGFVSRILTVSLASAATLFLSSPSAYFTFLAVLSTIAFAIALLLPSDR 382 Aeropyrum pernix
WP_010879783 332 VGLTSRAISVALTLGAMYFISSAELYFTYLTIPITVAFILTLLLPNDR 379 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap