Conserved Protein Domain Family
2A0127

?
TIGR00902: 2A0127 
phenyl proprionate permease family protein
This family of proteins is involved in the uptake of 3-phenylpropionic acid. This uptake mechanism is for the metabolism of phenylpropanoid compounds and plays an important role in the natural degradative cycle of these aromatic molecules. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129980
View PSSM: TIGR00902
Aligned: 2 rows
Threshold Bit Score: 537.592
Threshold Setting Gi: 2495642
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P44629   1 MQVRPFYWLALSFLGYYCAYGVFLPFFPAWLKSQQYGEEMIGLVIGSAYIFRFAGGLFFSSLIKKANHIIIALRLLALAS 80  Haemophilus influenza...
Q47142   1 MVLQSTRWLALGYFTYFFSYGIFLPFWSVWLKGIGLTPETIGLLLGAGLVARFLGSLLIAPRVSDPSRLISALRVLALLT 80  Escherichia coli K-12
P44629  81 AIIMAAMSLVAHNFWLLFIAIGlYASVNSAGMPIGDSLASTWQRQIGLDYGKVRLIGSAAFILGVVVFGGMIGWVGEQNI 160 Haemophilus influenza...
Q47142  81 LLFAVAFWAGAHVAWLMLVMIG-FNLFFSPLVPLTDALANTWQKQFPLDYGKVRLWGSVAFVIGSALTGKLVTMFDYRVI 159 Escherichia coli K-12
P44629 161 VWILTALLSFYTIIQLLKPTIPPKDEIPEDSVQNDVGFIALLKnpMTLRVMIAVGLIQGSHAAYYVYSTIYWTSIGISVS 240 Haemophilus influenza...
Q47142 160 LALLTLGVASMLLGFLIRPTIQPQGASRQQESTGWSAWLALVR--QNWRFLACVCLLQGAHAAYYGFSAIYWQAAGYSAS 237 Escherichia coli K-12
P44629 241 QTSLLWGIGVLAEIVLFFFSRRLFQNISISVLLYISALACVGRWAVIGYIEDFWLIFLLQLMHSLTYAVCHYAIVRYITT 320 Haemophilus influenza...
Q47142 238 AVGYLWSLGVVAEVIIFALSNKLFRRCSARDMLLISAICGVVRWGIMGATTALPWLIVVQILHCGTFTVCHLAAMRYIAA 317 Escherichia coli K-12
P44629 321 QPQSHIAKLQGLYNGLSNGVLIAIFTAIAGMIYPTSPAMTFVFMSIIAAAAFFVIPRKLNAF 382 Haemophilus influenzae Rd KW20
Q47142 318 RQGSEVIRLQAVYSAVAMGGSIAIMTVFAGFLYQYLGHGVFWVMALVALPAMFLRPKVVPSC 379 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap