Conserved Protein Domain Family
2A0121

?
TIGR00900: 2A0121 
H+ Antiporter protein
[Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 162098
View PSSM: TIGR00900
Aligned: 10 rows
Threshold Bit Score: 301.162
Threshold Setting Gi: 5739392
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB49999       5 FWLFVAGRFISQLGWAIQEVALPL--YVLD-VTHSAKIMTLFVLADLIPSIITTPIAGVFGDRYDRKKIMVGFDLIRGVL 81  Pyrococcus abys...
AAC44785      11 FYTIWAGQAVSLITSAILQMAIIF--YLTE-KTGSAMVLSMASLLGFLPYAVFGPAIGVLVDRHDRKKIMIGADLIIAAA 87  Streptococcus p...
CAA63510      13 FYLFLIGQLLTGVTSMIVQYAIIW--YLTL-ETGEESVLAIATLVGMLPMALLSPFVGPFIDRINKKFLLISYDAVVAVI 89  Lactococcus lac...
CAB50049       8 FWLFAVGRWISIAGWAIQDVAIPL--YVLD-KTGSGTMMSLFVMAELIPRILVNPIAGVIGDRYNRKYLMVGFDLIRGVL 84  Pyrococcus abys...
CAA03986       9 LLLILFAALTAGAGNGITIVAFPW--LVLQ-HNGSALDASIVAMAGTLPLLVATLIAGAAVDYLGRRRVSMISDLLSALS 85  Mycobacterium f...
AAD50454      26 FRLLVGSHLLNETGAAATLVVLPLt-AVLA-LDASAWQTALIESAYFCAYLVLGLPAGALVERARPRRVMIGADAVRCVA 103 Streptomyces sp...
AAB84282      21 YRLLIAAVTLSIFAEGMWSVVMAL--QVIA-IDNDPASLSLVATCLGVGLVAFVLVGGITADRINQRTIIIAVEVVNFVT 97  Mycobacterium s...
AAA72441      38 YRHLFTAQVIALIGTGLATVALGLlaYDLA-GANAGSVLGTALAIKMVAYVGVAPVVGAYANRLPRRAFLVAMDLIRAAV 116 Plasmid pTOM9
CAA10866       9 FVRLFFAALASQMGTTVGNMAFAF--FLLDrFSSQPSYTTLAELMYSLPTIFVFLIVGVVADRFDRKKVAENCDWIRAGL 86  Bacillus subtil...
WP_010873929  16 FAQLYLAQAISLLGDALTWVGLALlaFELA-GQGAGLILAGALTLRVTVFVLLSPIAGAIADRYDRKQMMVITHLARLGI 94  Synechocystis s...
CAB49999      82 LFLVIAFNFL------TIRCLLVVQVIMAIMNAFFSAGTGAMYPDLVKPE--ELERANSIVMSASIISR-LVGPAIGGFV 152 Pyrococcus abys...
AAC44785      88 GSVLTIVAFYme---lPVWMVMIVLFIRSIGTAFHTPALNAVTPLLVPEE--QLTKCAGYSQSLQSISY-IVSPAVAALL 161 Streptococcus p...
CAA63510      90 ALGLFIYGINnd--vyPLWMVFVTIGIRAVAQTAQMPTVQSIMPTMVPED--EITRVNGQFGIIQSLIV-IVSPGIGAFM 164 Lactococcus lac...
CAB50049      85 LFFVLFFNLL------ELEQLLVIQVIMSIFGSFFAAGTSGMFPDLVPKD--RLMQANSILQMGTQVIN-IVSPVIGGAI 155 Pyrococcus abys...
CAA03986      86 VAAVPVLALIfgvdavNVAVLAVLAGLGAFFDPAGMTARETMLPEAAGRAgwTLDHANSVYEAVFNLGY-IVGPGIGGLM 164 Mycobacterium f...
AAD50454     104 LASLPLAWAAdg---lSLPMVYAVALLLGCAQLFGDIADHSYLPRLVREE--QLVQGNSTLQLIRSGAE-LGGPGLGGLS 177 Streptomyces sp...
AAB84282      98 VAVISALALLgv---lKIWHMAVAAGILGIAAAFFFPAYSAILPRILPPE--QLLAANGVEGVVRPVFQrSVGPAVAGMV 172 Mycobacterium s...
AAA72441     117 AISLPFVN--------EIWQIYILIFVLQSASAAFTPTFQATIPDVLRDEk-DYTRALSLSRLAYDMES-LVSPMLAAAL 186 Plasmid pTOM9
CAA10866      87 TVVLFFTLFTg-----NIPLVFCILFIRSAVTKFFFPAENSLVQAILPKE--HYAKAAGLNQMLFSIFM-VFGVGIGAFM 158 Bacillus subtil...
WP_010873929  95 VCLFPGVT--------QAWQIYGLVLGLNVFNAFFTPTYTATIPLVTKED--EYPQAIALSSATYQLLG-VLGPGLAGSL 163 Synechocystis s...
CAB49999     153 YGFGGIKLAILMNAISFFGSGLFEIFIKYEWKTR-NIEGFS-------DFVRDIKEGLKFIMSNSFISTLIGLVILLNAL 224 Pyrococcus abys...
AAC44785     162 YSVWELNAIIAIDVLGAVIASITVAIVRIPKLGD-RVQSLDp------NFIREMQEGMAVLRQNKGLFALLLVGTLYMFV 234 Streptococcus p...
CAA63510     165 VATMPIHWVILLDVIGFILGAGMLLLVRIPEVAS-QGEKIS--------VIRDTLEGFKILRENKPMWKMTLIGALFMLL 235 Lactococcus lac...
CAB50049     156 YGLGGIKAAIFINAISFFGSGLFEISIRYEWKGK-GEK--F-------AILREFLDGIKLIKSSKPLLILGSLSIILNAL 225 Pyrococcus abys...
CAA03986     165 IATLGGINTMWVTAGAFCCSILAISVLRLEGAGApDRSVLTe------AVLAGIVEGLRFVWYTPVLRTLAIVDLVATGL 238 Mycobacterium f...
AAD50454     178 VQWLGAYWALAANAVGSAVSAVLLWRIKVPEPEP---PALAh------GLARQTWEGLSFVRRQPVLRMLAVSASLNNLV 248 Streptomyces sp...
AAB84282     173 IGATMPSIGAVVVAVLFALGLALLVATRPPAQPAsEHHERP-------HVLRDLREGFAFVLKTPWLLWTVLFASMFVLV 245 Mycobacterium s...
AAA72441     187 LSVISFHWLFGGTVVGFLISAALVVSVSLPQSRAkEITG---------SIYAKTFRGISIYLRTPRLKGLLALNLAAAAA 257 Plasmid pTOM9
CAA10866     159 YNTIGIEGAIILDFVSFIISGLLIRSCRIPKEARqPNGAFSwrktsvkDSINDFREGILYILKNKLLASLIFGFFIFGFV 238 Bacillus subtil...
WP_010873929 164 AAWVGTKTIFWGDALTFLMAAGLIFTLPGKLLANsTAQPVRnl----aQIRRDIGTGTQCLFGDRLIRYALAMQLVVSLA 239 Synechocystis s...
CAB49999     225 GAPFAsIIYPYAMREI---LKFSSQQFGLVESAFMLGALIGNLIVGaflgaKAGRYIFRLFLVNGA-VELIFILIISPFL 300 Pyrococcus abys...
AAC44785     235 YMPIN-ALFPLISMDY---FNGTPVHISITEISFASGMLIGGLLLG-----LFGNYQKRILLITAS-IFMMGISLTISGL 304 Streptococcus p...
CAA63510     236 FMPAM-SLYPLVTTKY---FGGTIVHAGWVEVLFAAAMLIGSFAVG-----IFGKTKDRMPWIIAA-YLIIGLSIGGSGF 305 Lactococcus lac...
CAB50049     226 FSPLFaIVFPYIVRVV---LRLSSIQFGSVQTALTLGMLLGNLIIAsilknSAGKHFMKAILIQ---ELFILIVPFTPKL 299 Pyrococcus abys...
CAA03986     239 YMPMEsVLFPKYFTD-----RNEPTELGWVLMALSIGGLLGALGYA-----VMSRYMSRRATMLTA-VITLGVAMTVIAF 307 Mycobacterium f...
AAD50454     249 FSAAF-ALDVVFLSKV---VGVPAGLVGVLLASGAVGALAGAWLTP-----RLARRFGDARTATLA-VPVAAPFLLLAPL 318 Streptomyces sp...
AAB84282     246 VLGPIeVLLPFIAQDR---FADGARAYGFILAFFGIGSAMGALTVSsr--rMPRRYLTTMMLMWG----LGSIPLVIVGY 316 Mycobacterium s...
AAA72441     258 SAMVIvNTVVYVQSK----LQRPSTDVPFALAAFGCGSMLVALLLPr----LLDKRPDRPAMLTGAtIMAIGLAVGSLVA 329 Plasmid pTOM9
CAA10866     239 N--GGfAVLPMFTMKYglaPDRYEWHTSVFTIALGFGLLAGSVIGT-----LISKKVKPHFLMSIP-IFIAGLLIFVLGY 310 Bacillus subtil...
WP_010873929 240 GAGILvNTVGYVQG-I---LNLGKLEYGWLMAAFGLGATVASLGLG-----NTQQQRKRIYLTTIG-AVVMSLAILPVSM 309 Synechocystis s...
CAB49999     301 ALprNsaFMLLLVLGATMGMAGAMINVPLASKLQRAVPSEIRGRVFSTMEMLARIANPLSLVVVGPLVDTIG 372 Pyrococcus abyssi GE5
AAC44785     305 LP--QsgFFIFVVCCAIMGLSVPFYSGVQTALFQEKIKPEYLGRVFSLTGSIMSLAMPIGLILSALFADRIG 374 Streptococcus pyogenes
CAA63510     306 LPgnMngFWVFLVLNVFAGIVGQIYTTMNMAITQQSFEAQYLGRVMGIVSALMSIAGPVGLIFAAPVAESIG 377 Lactococcus lactis subs...
CAB50049     300 SYprN--YLVILTSAFAIGFFNVLVNIPIMTKLQTIVPREYRARFFSTLETLSMGATPLGMIIVGPTIDKLG 369 Pyrococcus abyssi GE5
CAA03986     308 LPp----LPLILVLCAIVGFVYGPIAPIYNYVMQTTAPQHLRGRVVGVMGSLAYAAGPLGLILAGPLADAAG 375 Mycobacterium fortuitum
AAD50454     319 TQddWr-VLLFALAHLAISVGVTVFNILQVTYRQRVCPADLLSRVSAIFRFAVWGAAPLGALAGGALAAHLG 389 Streptomyces spectabilis
AAB84282     317 TSs----FPLMAAATFVIGVTDGAGMVIWGTLLQRRVPTEMLGRVSSLDFFVSLAFMPLSFAIVGPLSKVVS 384 Mycobacterium smegmatis...
AAA72441     330 FAggPfeWHALLLTWFGIGVGYSMTQTPSGRLLKRSASSADRPAVFAAQFSLSHACWLITYPLAGQLGARLG 401 Plasmid pTOM9
CAA10866     311 TN--I--LWVYYAAAFALGMCIGPINIAIGGWMPKIVHPKLMGRVSGMQDPFMMFAQSLTLGLVALLFPKFV 378 Bacillus subtilis subsp...
WP_010873929 310 VN-----LQGLLLLWAGAGIGQTLVNVPTQTLIADRVAKELQGRVYGANFAWSHLWWAFSYPLAGWLGSHFA 376 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap