Conserved Protein Domain Family
2A0120

?
TIGR00899: 2A0120 
sugar efflux transporter
This family of proteins is an efflux system for lactose, glucose, aromatic glucosides and galactosides, cellobiose, maltose, a-methyl glucoside and other sugar compounds. They are found in both gram-negative and gram-postitive bacteria. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129977
View PSSM: TIGR00899
Aligned: 5 rows
Threshold Bit Score: 478.882
Threshold Setting Gi: 5777416
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31436    18 AFLLVAFLTGIAGALQTPTLSIFLADELKARPIMVGFFFTGSAIMGILVSQFLARHSDKQGDRKLLILLCCLFGVLACTL 97  Escherichia coli K-12
P33026    19 AFLIVAFLTGIAGALQTPTLSIFLTDEVHARPAMVGFFFTGSAVIGILVSQFLAGRSDKRGDRKSLIVFCCLLGVLACTL 98  Escherichia coli K-12
CAB53452  19 AFLVIAFLTGIAGALQLPTLSLFLSTEVQVRPFMVGLFYTGSAVIGIVVSQILATYSDRQGDRKTLILQCCLLGALACLL 98  Erwinia chrysanthemi
P31675    17 AFMLVAFMMGVAGALQAPTLSLFLSREVGAQPFWIGLFYTVNAIAGIGVSLWLAKRSDSQGDRRKLIIFCCLMAIGNALL 96  Escherichia coli K-12
Q45632    15 VFPLFYFLIFFAFGALFPLLSVYLQEEARLSGAAIGWIMSLPPIVTMAAQPLWGTAADYTRKPVGLLLAALVLAALFGVM 94  Geobacillus stearot...
P31436    98 FAWNRNYFILLSTGVLLSSFASTANPQMFALAREHADRTGRETVMFSTFLRAQISLAWVIGPPLAYELAMGFSFKVMYLT 177 Escherichia coli K-12
P33026    99 FAWNRNYFVLLFVGVFLSSFGSTANPQMFALAREHADKTGREAVMFSSFLRAQVSLAWVIGPPLAYALAMGFSFTVMYLS 178 Escherichia coli K-12
CAB53452  99 YAWNRNYFVLLFIGVLLSSFGSTANPQLFALAREHADRTGRGAAMFSSVMRAQISLSWVIGPPVAFALALGFGFPAMYLT 178 Erwinia chrysanthemi
P31675    97 FAFNRHYLTLITCGVLLASLANTAMPQLFALAREYADNSAREVVMFSSVMRAQLSLAWVIGPPLAFMLALNYGFTVMFSI 176 Escherichia coli K-12
Q45632    95 YALAGSYRLFVVLTVLLSAMQSAIVPLSDSLALRHVHEQGGN----YGAIRLWGSLGFAMAVLAVGWLSDHIAFAVIFYA 170 Geobacillus stearot...
P31436   178 AAIAFVVCGLIVWLFLPSIQRNIPVVTQPVEILpsTHRKRDTRLLFVVCSMMWAANNLYMINMPLFIIDELHLTDKLTGE 257 Escherichia coli K-12
P33026   179 AAVAFIVCGVMVWLFLPSMRKELPLATGTIEAP--RRNRRDTLLLFVICTLMWGSNSLYIINMPLFIINELHLPEKLAGV 256 Escherichia coli K-12
CAB53452 179 AAVVFVLCGLLVWLLLPSMPKTRVKSAATLESP--RQNRRDTLLLFTACTLMWTCNGIYLINMPLYLVNELRLPEKLAGV 256 Erwinia chrysanthemi
P31675   177 AAGIFTLSLVLIAFMLPSVARVELPSENALSMQg-GWQDSNVRMLFVASTLMWTCNTMYIIDMPLWISSELGLPDKLAGF 255 Escherichia coli K-12
Q45632   171 FSLALLTAAALATR-LPRYPMGAPGALTRQDVRg-LLASRPFRLLLVATFLLFG-PILANNSYFGLLIHELGGTLTGIGL 247 Geobacillus stearot...
P31436   258 MIGIAAGLEIPMMLIAGYYMKRIGKRLLMLIAIVSGMCFYASVLMATTPAVELELQILNAIFLGILCGIGMLYFQDLMPE 337 Escherichia coli K-12
P33026   257 MMGTAAGLEIPTMLIAGYFAKRLGKRFLMRVAAVGGVCFYAGMLMAHSPVILLGLQLLNAIFIGILGGIGMLYFQDLMPG 336 Escherichia coli K-12
CAB53452 257 MMGTAAGLEIPVMLLAGYLTSRLGKRLLMRLAVIAGLIFYTGLTLLNGSWALLALQLLNAIFIGILAGMGMLYFQDLMPG 336 Erwinia chrysanthemi
P31675   256 LMGTAAGLEIPAMILAGYYVKRYGKRRMMVIAVAAGVLFYTGLIFFNSRMALMTLQLFNAVFIGIVAGIGMLWFQDLMPG 335 Escherichia coli K-12
Q45632   248 AFLFAAGSEAPFMKAADRLIGRFGMVRLLLLAALISAARWLAYAADPPLWFVYMTTVVQGCSVGLAIPTALQYARRLAPE 327 Geobacillus stearot...
P31436   338 KIG-SATTLYANTSR-VGWIIAGSVDGIMVEIWSYHALFWLAIGMLGIAMICLLFIKD 393 Escherichia coli K-12
P33026   337 QAG-SATTLYTNTSR-VGWIIAGSVAGIVAEIWNYHAVFWFAMVMIIATLFCLLRIKD 392 Escherichia coli K-12
CAB53452 337 QAG-AATTLFTNTTR-VGWIISGSLAGIVAEVWSYHAGFVIAIAMLAGAAVCMWRIRD 392 Erwinia chrysanthemi
P31675   336 RAG-AATTLFTNSIS-TGVILAGVIQGAIAQSWGHFAVYWVIAVISVVALFLTAKVKD 391 Escherichia coli K-12
Q45632   328 RVQsTAVALYSAVGNgLGAWFCTLVGGYLLERWQIGAVYLFFSICTIVGVLVLLLLAK 385 Geobacillus stearothermophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap