Conserved Protein Domain Family
2A0118

?
TIGR00897: 2A0118 
polyol permease family
This family of proteins includes the ribitol and D-arabinitol transporters from Klebsiella pneumoniae and the alpha-ketoglutarate permease from Bacillus subtilis. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 162096
View PSSM: TIGR00897
Aligned: 3 rows
Threshold Bit Score: 559.068
Threshold Setting Gi: 7673989
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O52718   1 MSINNKQWLGLPLNLLWGYIAIAVFMTGDGFELAFLSHYIKALGFSPAEASFAFTLYGLAAALSAWISGVVAEIITPLKT 80  Klebsiella pneumoniae
O05390   6 AKGNVLNKIGIPSHMVWGYIGVVIFMVGDGLEQGWLSPFLVDHGLSMQQSASLFTMYGIAVTISAWLSGTFVQTWGPRKT 85  Bacillus subtilis sub...
O34864   1 ----MLDKIGIPKRLAWGFLGVVLFMMGDGLEQGWLSPFLIENGLTVQQSASIFSIYGIALAIASWFSGVCLEAFGAKRT 76  Bacillus subtilis sub...
O52718  81 MMIGFVLWCVFHVLFLVFGLGHANYALILLFYGIRGFAYPLFLYSFIVAIVHNVKSDNASSAIGWFWAVYSIGIGVFGSY 160 Klebsiella pneumoniae
O05390  86 MTVGLLAFILGSAAFIGWAIPHMYYPALLGSYALRGLGYPLFAYSFLVWVSYSTSQNILGKAVGWFWFMFTCGLNVLGPF 165 Bacillus subtilis sub...
O34864  77 MFMGLLFYVIGTAAFIVFGFEQLNLPVMYVTYFVKGLGYPLFAYSFLTWVIYRTPQSKLSTAVGWFWIAYCLGMFVFGAW 156 Bacillus subtilis sub...
O52718 161 IPSFTIPHIGEMGTLWLALAFCLTGGVIALVSLRHIQTPQHMQnltTREKFSELGRAATLLYTNRNILLSSMVRIINTLS 240 Klebsiella pneumoniae
O05390 166 YSSYAVPAFGEINTLWSALLFVAAGGILALFFNKDKFTPIQKQ---DQPKWKELSKAFTIMFENPKVGIGGVVKTINAIG 242 Bacillus subtilis sub...
O34864 157 YSSYAIKAFGYLNTLWSSIFWVCLGAFFALFINKDRFEKKKRK---RSETAEELLKGVTILFTNPRVLTGGIIRIINSIG 233 Bacillus subtilis sub...
O52718 241 LFGFAVIMPmMFVDELGFSTSEWLQVWAVFFFTTIFSNVLWGILGEKLGWMKVVRWFGCIGMALSSLAFYYIPQHFGHSF 320 Klebsiella pneumoniae
O05390 243 QFGFAIFLP-TYLARYGYSVSEWLQIWGTLFFVNIVFNIIFGAVGDKLGWRNTVMWFGGVGCGIFTLALYYTPQLIGHQY 321 Bacillus subtilis sub...
O34864 234 TYGFPVFLP-MHMAQHGISTNVWLQIWGTIFLGNIVFNLIFGIVGDKFGWKNTVIWFGGVGCGIFTVLLYYAPVFSGGSL 312 Bacillus subtilis sub...
O52718 321 AMALIPAIALGIFVAAFVPLAAVFPALEPKHKGAAISVYNLSAGMSNFLAPAIAVVLLPFFSTIGVVIAYTALYVVAFFL 400 Klebsiella pneumoniae
O05390 322 WVLMIIACCYGAALAGYVPLSALLPTLAPDNKGAAMSVLNLGSGLCAFIAPGIVSLFIGPLGAGGVIWIFAALYFFSAFL 401 Bacillus subtilis sub...
O34864 313 AVVSVIGFIWGGLLAGYVPIGAIVPTVAGKDKGAAMSVLNLAAGLSAFVGPALAWLFIGLVGAQGVVWIFAALYLASAVL 392 Bacillus subtilis sub...
O52718 401 CAFIRV 406 Klebsiella pneumoniae
O05390 402 TRFLTI 407 Bacillus subtilis subsp. subtilis str. 168
O34864 393 TKCIHI 398 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap