Conserved Protein Domain Family

TIGR00896: CynX 
cyanate transporter
This family of proteins is involved in active transport of cyanate. The cyanate transporter in E.Coli is used to transport cyanate into the cell so it can be metabolized into ammonia and bicarbonate. This process is used to overcome the toxicity of environmental cyanate. [Transport and binding proteins, Other]
PSSM-Id: 129974
Aligned: 5 rows
Threshold Bit Score: 379.099
Threshold Setting Gi: 2506999
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P37482   317 SLALTLIGLRSENAQQAAALSGMSQSFGYLLAAVGPIFVGYLFDQTHSWTMP 368 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap