Conserved Protein Domain Family
CynX

?
TIGR00896: CynX 
cyanate transporter
This family of proteins is involved in active transport of cyanate. The cyanate transporter in E.Coli is used to transport cyanate into the cell so it can be metabolized into ammonia and bicarbonate. This process is used to overcome the toxicity of environmental cyanate. [Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 129974
View PSSM: TIGR00896
Aligned: 5 rows
Threshold Bit Score: 379.099
Threshold Setting Gi: 2506999
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB50880  22 LILGIVLAAVNLRPAITSLGALLEEVRDGLGMSGSIAGLLTSVPPLCFAVFGVTAPRLARRFGPGAVVCAGMVAITAGLL 101 Streptomyces coelic...
P37482    14 LITGIIFIAFNLRPAITSVGPVISSIRAELHMSNGAAGFLTALPLLSFAVLSPLAPKLGQRLGNERTLWLGLVILLIGVL 93  Bacillus subtilis s...
P76242    15 LIAGILMIATTLRVTFTGAAPLLDTIRSAYSLTTAQTGLLTTLPLLAFALISPLAAPVARRFGMERSLFAALLLICAGIA 94  Escherichia coli K-12
AAC05645  38 LLLGLILVALNLRPALSSVAPLLADVSSSLGLSAAKAGLLTTLPVLCLGLFAPTAPILARRFGAERVVLGILLTLAAGII 117 Pseudomonas margina...
P17583     1 MLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSVAALLTALPVVTMGGLALAGSWLHQHVSERRSVAISLLLIAVGAL 80  Escherichia coli K-12
CAB50880 102 IRpYAGGTGGFLAATALALMGIAVSNVLMPVIVKRYFPDRVGSMTGLYSMALAFGTSVAAAATVPLTDALGGHWQPGLAV 181 Streptomyces coelic...
P37482    94 TR-STGYTAALFFGTALIGVGIAIGNVLLPSLIKHKYPEKPGIMISLYTTSMNIFAALASGVSVPLATQMNGGWKQAFLL 172 Bacillus subtilis s...
P76242    95 IR-SLPSPYLLFGGTAVIGGGIALGNVLLPGLIKRDFPHSVARLTGAYSLTMGAAAALGSAMVVPLALNGFG-WQGALLM 172 Escherichia coli K-12
AAC05645 118 LR-SAFGEVGLFAGSLIAGASIGIIGVLLPGLIKRDFARQAGAMTGVYTMALCLGAALAAGATVPLSHYFGDRWTIGLGF 196 Pseudomonas margina...
P17583    81 MReLYPQSALLLSSALLGGVGIGIIQAVMPSVIKRRFQQRTPLVMGLWSAALMGGGGLGAAITPWLVQHSET-WYQTLAW 159 Escherichia coli K-12
CAB50880 182 WAVLPALAVLPWIPFVRNRKAPASTAPyaprpedgrsaekraeQPPLRITRSRTAWALAVFFGLQATAAYITMGWMAQIF 261 Streptomyces coelic...
P37482   173 WGGLALLALLIWIPQLRHRDTANQTMK----------------LQSSSIWASKMAWYVTIFMGLQSFLFYSSIAWFPEIL 236 Bacillus subtilis s...
P76242   173 LMCFPLLALFLWLPQWRSQQHANLSTSr--------------aLHTRGIWRSPLAWQVTLFLGINSLVYYVIIGWLPAIL 238 Escherichia coli K-12
AAC05645 197 WILPALAAALFWLPQVGRKHATHQVAYr-----------------VKGLLRDPLAWQVTLYMGLQSSLSYIVFGWLPSIL 259 Pseudomonas margina...
P17583   160 WALPAVVALFAWWWQSAREVASSHKTTt----------------TPVRVVFTPRAWTLGVYFGLINGGYASLIAWLPAFY 223 Escherichia coli K-12
CAB50880 262 RDSGVSAGTAGLLLAVIMVMGVPLAFVIPRVASRLPHQGPIVVVLGVCGLAGYAGLYFAPVGGAWA-WALLLGVSN-CAF 339 Streptomyces coelic...
P37482   237 RSHGIDTATAGWMVSLMQFASLPSTFLTPVLADRVKQQRGIVAALASVYLIGLCGLLAGGSHTLLAiWMIIIGIGQgSSI 316 Bacillus subtilis s...
P76242   239 ISHGYSEAQAGSLHGLLQLATAAPGLLIPLFLHHVKDQRGIAAFVALMCAVGAVGLCFMPAHAIT--WTLLFGFGSgATM 316 Escherichia coli K-12
AAC05645 260 IGRGLNATEAGLALSGSIIVQLLSSLAAPWLATRGKDQRVAIVVVMLLTLGGLFGCLYAPLDGLWG-WSIVLGLGQgGTF 338 Pseudomonas margina...
P17583   224 IEIGASAQYSGSLLALMTLGQAAGALLMPAMARHQ-DRRKLLMLALVLQLVGFCGFIWLPMQLPVL-WAMVCGLGLgGAF 301 Escherichia coli K-12
CAB50880 340 PLALTMVGMRARTGAGVAQLSAFAQSTGYLISIPGPLLVGVLYQHSGGWGLP 391 Streptomyces coelicolor A3(2)
P37482   317 SLALTLIGLRSENAQQAAALSGMSQSFGYLLAAVGPIFVGYLFDQTHSWTMP 368 Bacillus subtilis subsp. subtilis str. 168
P76242   317 ILGLTFIGLRASSAHQAAALSGMAQSVGYLLAACGPPLMGKIHDANGNWSVP 368 Escherichia coli K-12
AAC05645 339 SLALTLIVLRSRDAHVAANLSSMAQGIGYTLASLGPLAVGLLHDWTAAGPPP 390 Pseudomonas marginalis pv. alfalfae
P17583   302 PLCLLLALDHSVQPAIAGKLVAFMQGIGFIIAGLAPWFSGVLRSISGNYLMD 353 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap