Conserved Protein Domain Family
2A0114euk

?
TIGR00894: 2A0114euk 
Na(+)-dependent inorganic phosphate cotransporter
[Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 129972
View PSSM: TIGR00894
Aligned: 6 rows
Threshold Bit Score: 565.524
Threshold Setting Gi: 3879653
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA87340   5 KECVFVSEKSKIFPSTRLFFSFLLCLCFVALAIGTSNISQSMVCMVKKPDTN-YTCPLAEPEVEAIpc------------ 71  Caenorhabditis elegans
Q62795     1 MENRCLPKKVPGFCSFRYGLAILLHFCNIVIMAQRVCLNLTMVAMVNKTEPPhLSNKSVAEMLDNV-------------- 66  Norway rat
CAA50490   3 MDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHgLPNTSTKKLLDNI-------------- 68  human
Q28722     1 MDNQFPSRKGPCFCSFRYVLALFMHFCNIVIIAQRMCLSLTMVAMVNNTNLHgSPNTSAEKRLDNT-------------- 66  rabbit
AAC39088   1 ----------------MLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEEEYdDECGDRDIPIDDS-------------- 50  Drosophila ananassae
CAA68992   1 MGQVEARTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTdLAALAEMNERFSLerwfldwanipyek 80  fruit fly
CAA87340  72 -nHPKQFAWSSIQQGLIYSGQNFGSLFMVITG-WQADRLNGKWTIVAAMAFIIVSNAVLPISAGASFAL-VFFLRVLTGF 148 Caenorhabditis elegans
Q62795    67 --KNPVHSWSLDIQGLVLSSVFLGMVVIQVPVgYLSGAYPMEKIIGSSLFLSSVLSLLIPPAAQVGAAL-VIVCRVLQGI 143 Norway rat
CAA50490  69 --KNPMYNWSPDIQGIILSSTSYGVIIIQVPVgYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVAW-VVVCRAVQGA 145 human
Q28722    67 --KNPVYNWSPDVQGIIFSSIFYGAFLIQIPVgYISGIYSIKKLIGFALFLSSLVSIFIPQAAAVGETW-IIVCRVVQGI 143 rabbit
AAC39088  51 --QDGEFPWNAALQGYILSSFFYGYVITQIPFgILAKKYGSLRFLGYGMLINSVFAFLVPVAAREGGVWgLCAVRFIQGL 128 Drosophila ananassae
CAA68992  81 ngFHWNEKQQGALLGSFFWAHWTLQIPGGILAtKYGTKLVFGWSNGIGVFCCFLIPIVSYWSYTGLIIL-RVFQGWITGL 159 fruit fly
CAA87340 149 GDALLSPASSSLITRWFPPKERPSALGIVTSGRQIGTLIILPIGGWLCGSdgskflGGWPAIFYLSSVVAAAVLVIWVVF 228 Caenorhabditis elegans
Q62795   144 AQGAVSTGQHGIWVKWAPPLERGRLTSMTLSGFVMGPFIALLVSGFICDL------LGWPMVFYIFGIVGCVLSLFWFIL 217 Norway rat
CAA50490 146 AQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICES------LGWPMVFYIFGACGCAVCLLWFVL 219 human
Q28722   144 TQGTVTTAQHEIWVKWAPPLERGRLTSMSLSGFLLGPFIVLLVTGIICES------LGWPMVFYIFGACGCAVCLLWFVL 217 rabbit
AAC39088 129 GEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYgf---dGGWPSIFYVFGIVGTVWSIAFLIF 205 Drosophila ananassae
CAA68992 160 AWPSMHVLTAKWIPPNERSKFVSAYLGSSVG-VALFYPIFGYIIDWTRWEw------VYYICGIVGTLWFIAWQFLVFDS 232 fruit fly
CAA87340 229 SADKPSKHLCISHNEEAYINRKIEEENIGkrnNRKNTPWKAIFTSKQVWVAVAALVCHEFPLVIMLQFLPKFFSDVLGLS 308 Caenorhabditis elegans
Q62795   218 LFDDPNNHPYMSSSEKDYITSSLMQQVHS---GRQSLPIKAMLKSLPLWAIILNSFAFIWSNNLLVTYTPTFISTTLHVN 294 Norway rat
CAA50490 220 FYDDPKDHPCISISEKEYITSSLVQQVSS---SRQSLPIKAILKSLPVWAISIGSFTFFWSHNIMTLYTPMFINSMLHVN 296 human
Q28722   218 YYDDPKDHPCVSLHEKEYITSSLIQQGSS---TRQSLPIKAMIKSLPLWAISFCCFAYLWTYSRLIVYTPTLINSMLHVD 294 rabbit
AAC39088 206 VYEDPSTHPKIDEREKKYINESLWGTDVI---KSPPIPFKSIVKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFS 282 Drosophila ananassae
CAA68992 233 PAEHPRIADSERKFIEKSLGASIQGSKGP---TPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRAT 309 fruit fly
CAA87340 309 NTVNGLVSALPMAILFLSKCLSASLASYLTANGYLRKTQSCKIFNFIASLGLGICIAATPLMSnlQHAIWAIIILCLANA 388 Caenorhabditis elegans
Q62795   295 VRENGLLSSLPYLLAYICGIVAGQMSDFLLSRKIFSVVAVRKLFTTLGIFCPVIFVVCLLYLS--YNFYSTVIFLTLANS 372 Norway rat
CAA50490 297 IKENGFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLS--STFYSIVIFLILAGA 374 human
Q28722   295 IRENGLLSSLPYLFAWICGVIAGHTADFLMSRNMLSLTAIRKLFTAIGLLLPIVFSMCLLYLS--SGFYSTITFLILANA 372 rabbit
AAC39088 283 LKSNGLLSSLPYLAMWLLSMFISVIADWMISSKRFSLTATRKIINSIGQYGPGLALIAASYTG--CDRALTLAILTIGVG 360 Drosophila ananassae
CAA68992 310 GFLSGLPHLMRMLFAYVFSIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNAT--AAIVLVTVATMLHGA 387 fruit fly
CAA87340 389 FAGLHTPGVLTAIVQLAPAFSGIITGLAFAVASCFSIFNKLLISQILRTGSK---HEWTIVFEISAFVAILPTIFFTLWG 465 Caenorhabditis elegans
Q62795   373 TLSFSFCGQLINALDIAPRYYGFLKAVTALIGIFGGLISSTLAGLILNQDPE---YAWHKNFFLMAGINVTCLAFYLLFA 449 Norway rat
CAA50490 375 TGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLILKQDPE---SAWFKTFILMAAINVTGLIFYLIVA 451 human
Q28722   373 SSSFCLGGALINALDLAPRYYVFIKGVTTLIGMTGGMTSSTVAGLFLSQDPE---SSWFKIFLLMSIINVISVIFYLIFA 449 rabbit
AAC39088 361 LNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGNLISDPSKpvmGQWQIVFFIAAFVYIICGTFYNIFG 440 Drosophila ananassae
CAA68992 388 VSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWk--NVFLLTSLMLTGSGILYVLFSESKL 465 fruit fly
CAA87340 466 SAERTEWASnrv-------------svpKDADQK 486 Caenorhabditis elegans
Q62795   450 KGDIQDWAK-------------------ETKTTR 464 Norway rat
CAA50490 452 TAEIQDWAK-------------------EKQHTR 466 human
Q28722   450 KAEIQDWAK-------------------EKQHTR 464 rabbit
AAC39088 441 SGERQFWDN-------------------PSEDEQ 455 Drosophila ananassae
CAA68992 466 QPWNSGCHQlpdsglkelqnlgrdqddeEEKKPL 499 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap