Conserved Protein Domain Family
2A0110

?
TIGR00889: 2A0110 
nucleoside transporter
This family of proteins transports nucleosides at a high affinity. The transport mechanism is driven by proton motive force. This family includes nucleoside permease NupG and xanthosine permease from E.Coli. [Transport and binding proteins, Nucleosides, purines and pyrimidines]
Statistics
?
PSSM-Id: 129967
View PSSM: TIGR00889
Aligned: 3 rows
Threshold Bit Score: 535.607
Threshold Setting Gi: 3025166
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45562         1 MSIAMRLKVMSFLQYFIWGSWLVTLGSYMINTLhFTGANVGMVYSSKGIAAIIMPGIMGIIADKWLRAERAYMLCHLVCA 80  Escherichia col...
P76417         1 MKTTAKLSFMMFVEWFIWGAWFVPLWLWLSKSG-FSAGEIGWSYACTAIAAILSPILVGSITDRFFSAQKVLAVLMFAGA 79  Escherichia col...
WP_000333541  17 MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLkFDGASIGAVYSSLGIAAVFMPALLGIVADKWLSAKWVYAICHTIGA 96  Enterobacteriaceae
P45562        81 GVLFYAASVTDPDMMFWVMLVNAMAFMPTIALSNSVSYSCLAqaglDPVTAFPPIRVFGTVGFIVAMWAVSLL------- 153 Escherichia col...
P76417        80 LLMYFAAQQTTFAGFFPLLLAYSLTYMPTIALTNSIAFANVP----DVERDFPRIRVMGTIGWIASGLACGFLpqilgya 155 Escherichia col...
WP_000333541  97 ITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYRLQnagmDIVTDFPPIRIWGTIGFIMAMWVVSLS------- 169 Enterobacteriaceae
P45562       154 HLELSSLQLYIASGASLLLSAYALTLPKIPvAEKKATTSLASKLGLDAFVLFKNPRMAIFFLFAMMLGAVLQITNVFGNP 233 Escherichia col...
P76417       156 DISPTNIPLLITAGSSALLGVFAFFLPDTP-PKSTGKMDIKVMLGLDALILLRDKNFLVFFFCSFLFAMPLAFYYIFANG 234 Escherichia col...
WP_000333541 170 GFELSHMQLYIGAALSAILVLFTLTLPHIPvAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNT 249 Enterobacteriaceae
P45562       234 FLHDFArnpefadsfvVKYPSILLSVSQMAEVGFILTIPFFLKRFGIKTVMLMSMVAWTLRFGFFAYG-DPSTTGFILLL 312 Escherichia col...
P76417       235 YLTEVG----------MKNATGWMTLGQFSEIFFMLALPFFTKRFGIKKVLLLGLVTAAIRYGFFIYGsADEYFTYALLF 304 Escherichia col...
WP_000333541 250 FLHSFDkdpmfassfiVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWILRFALFAYG-DPTPFGTVLLV 328 Enterobacteriaceae
P45562       313 LSMIVYGCAFDFFNISGSVFVEQEVDSSIRASAQGLFMTMVNGVGAWVGSILSGMAVDYFSVDG------VKDWQTIWLV 386 Escherichia col...
P76417       305 LGILLHGVSYDFYYVTAYIYVDKKAPVHMRTAAQGLITLCCQGFGSLLGYRLGGVMMEKMFAYQepvnglTFNWSGMWTF 384 Escherichia col...
WP_000333541 329 LSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMMTNGFGCILGGIVSGKVVEMYTQNG------ITDWQTVWLI 402 Enterobacteriaceae
P45562       387 FAGYALFLAVIFFFGFKYNHD---PEKIKHRAVTH 418 Escherichia coli K-12
P76417       385 GAVMIAIIAVLFMIFFRESDNeitAIKVDDRDIAL 419 Escherichia coli K-12
WP_000333541 403 FAGYSVVLAFAFMAMFKYKHV---RVPTGTQTVSH 434 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap