Conserved Protein Domain Family

TIGR00888: guaA_Nterm 
Click on image for an interactive view with Cn3D
GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit
This protein of purine de novo biosynthesis is well-conserved. However, it appears to split into two separate polypeptide chains in most of the Archaea. This N-terminal region would be the smaller subunit. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
PSSM-Id: 129966
Aligned: 14 rows
Threshold Bit Score: 294.222
Threshold Setting Gi: 13627227
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P49057       177 AAIADHQKALFGVQFHPEVVHSVGGIALIRNFVYHICHCE 216 Synechocystis sp. PCC 6803 substr. Kazusa
O25165       150 CAIENG--KIFGLQFHPEVVQSEEGGKILENFALLVCGCE 187 Helicobacter pylori 26695
Q50729       164 AAFEAFDRRLAGVQYHPEVMHTPHGQQVLSRFLHDFAGLG 203 Mycobacterium tuberculosis
WP_010885435 151 EAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAK-LCGel 189 Pyrococcus horikoshii
WP_010876348 149 EAMKHHDKPVYGIQFHPEVHHTREGHRVFENF-YDVCRS- 186 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap