1GPM,2LXN


Conserved Protein Domain Family
guaA_Nterm

?
TIGR00888: guaA_Nterm 
Click on image for an interactive view with Cn3D
GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit
This protein of purine de novo biosynthesis is well-conserved. However, it appears to split into two separate polypeptide chains in most of the Archaea. This N-terminal region would be the smaller subunit. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 129966
View PSSM: TIGR00888
Aligned: 14 rows
Threshold Bit Score: 294.222
Threshold Setting Gi: 13627227
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GPM_A        10 ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNP--SGIILSGGPESTTEENSPRAPQYVFEAGVPVFGVCY 87  Escherichia col...
P49057        29 IVILDFGSQYSELIARRIRETEVYSEVLSYRTTAQQLREIKP--KGIILSGGPNSVYDQGAPECDPEIFQLGVPVLGVCY 106 Synechocystis s...
O25165         2 ILVLDFGSQYTQLIARRLRERGIYTEIVPFFESIENIQKKAP--KGLILSGGPASVYAKDAYKPSGKIFDLNVPILGICY 79  Helicobacter py...
O66601         6 ILVVNFGSQYVQLIARRVRELGVYSEIVHWDTPVEEIKKKNP--YGIIFSGGPASVYAEGAPLPDKRIYELGVPILGICY 83  Aquifex aeolicu...
CAA89932      14 ILVLDFGSQYSHLITRRLREFNIYAEMLPCTQKISELG-WTP--KGVILSGGPYSVYAEDAPHVDHAIFDLNVPILGICY 90  baker's yeast
Q9Y933        10 VLVVDFGGQYAHLIARRIRELGVYSEIVPATS-LDALGEALPraAGVVLSGGPGSVWGSRHDEAAAMVLQLGKPVLGICY 88  Aeropyrum perni...
Q50729        17 VLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQP--VALVLSGGPASVYADGAPKLDPALLDLGVPVLGICY 94  Mycobacterium t...
WP_009968830   9 ILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEIKKMNP--KGIILSGGPNSVYDENSFRCDEKIFELDIPVLGICY 86  Bacillus subtilis
WP_010885435   3 IVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNP--KGIIFSGGPSLENTGNCEKVLEHYDEFNVPILGICL 80  Pyrococcus hori...
WP_010876348   4 ILIINNHGQYNHRIHRTLRYLQIPSELVPNTTPLDEIISRDP--EGLILGGGPSLERSGNCVEYIQK---LEIPILGICL 78  Methanothermoba...
1GPM_A        88 GMQTMAMQLGGHVEASNEREFGYAQVEVVNDS-ALVRGIEDaltadgkpLLDVWMSHGDKVTAIPSDFITVASTE-SCPF 165 Escherichia col...
P49057       107 GMQLMVKQLGGRVERAKRGEYGKASLHIDDPT-DLLTNVEN--------DSTMWMSHGDSCVDLPTGFEILAHTD-NTPC 176 Synechocystis s...
O25165        80 GMQYLVDFFGGVVVGANEQEFGKAVLEITQNS-VIFEGVKI--------KSLVWMSHMDKVIELPKGFTTLAKSP-NSPH 149 Helicobacter py...
O66601        84 GLQVITHQLGGKVVRSEKQEYGRARLRIIKED-VIFEGIPK--------ESDVWMSHADKVVELPEGFEVLAVSE-NSPY 153 Aquifex aeolicu...
CAA89932      91 GMQELAWINGKQVGRGDKREYGPATLKVIDDSnSLFKGMN---------DSTVWMSHGDKLHGLPTGYKTIATSD-NSPY 160 baker's yeast
Q9Y933        89 GHQLLAKVLGGEVGRSPLPEFGPTEVEVLDYG-ILLNGLPS--------RFKVWMSHYDAVLRPPGEAKVLARTP-GSPV 158 Aeropyrum perni...
Q50729        95 GFQAMAQALGGIVAHTGTREYGRTELKVLG-G-KLHSDLPE--------VQPVWMSHGDAVTAAPDGFDVVASSA-GAPV 163 Mycobacterium t...
WP_009968830  87 GMQLMTHYLGGKVEAASQREYGKANIRIEGTP-DLFRDLPN--------EQVVWMSHGDLVVEVPEGFTVDAATShHCPN 157 Bacillus subtilis
WP_010885435  81 GHQLIAKFFGGKVGRGEKAEYSLVEIEIIDED-EIFKGLPK--------RLKVWESHMDEVKELPPKFKILARSE-TCPI 150 Pyrococcus hori...
WP_010876348  79 GHQLIAKAYGGEVATAEAESYAQIELEILDED-DIFRGLGP--------RMSVWASHKDEVKKLPDEFDVLATSS-ICEV 148 Methanothermoba...
1GPM_A       166 AIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCE 205 Escherichia coli K-12
P49057       177 AAIADHQKALFGVQFHPEVVHSVGGIALIRNFVYHICHCE 216 Synechocystis sp. PCC 6803 substr. Kazusa
O25165       150 CAIENG--KIFGLQFHPEVVQSEEGGKILENFALLVCGCE 187 Helicobacter pylori 26695
O66601       154 AVIANREKKIYGFQFHPEVTHTVFGKEMLANFIYGVCKAE 193 Aquifex aeolicus VF5
CAA89932     161 CGIVHETKPIYGIQFHPEVTHSTQGKTLLKNFAVDLCHAK 200 baker's yeast
Q9Y933       159 AAMELWG-RVFGVQWHPEVRHTQYGREVLDNWLS-LVGAP 196 Aeropyrum pernix K1
Q50729       164 AAFEAFDRRLAGVQYHPEVMHTPHGQQVLSRFLHDFAGLG 203 Mycobacterium tuberculosis
WP_009968830 158 SAMSKADKKWYGVQFHPEVRHSEYGNDLLKNFVFGVCECE 197 Bacillus subtilis
WP_010885435 151 EAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAK-LCGel 189 Pyrococcus horikoshii
WP_010876348 149 EAMKHHDKPVYGIQFHPEVHHTREGHRVFENF-YDVCRS- 186 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap