Conserved Protein Domain Family
2A0109

?
TIGR00887: 2A0109 
phosphate:H+ symporter
This model represents the phosphate uptake symporter subfamily of the major facilitator superfamily (pfam00083). [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 129965
View PSSM: TIGR00887
Aligned: 8 rows
Threshold Bit Score: 725.367
Threshold Setting Gi: 6735503
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB81347  10 ALDVAKTQLY-------HFTTIVIAGMGFFTDAYDLFCISLVTKLLGRIYY--TepnpTRpGTLPPSAQSAVTGVALVGT 80  barrel medic
CAA74607  10 ALDVAKTQLY-------HFTAIVIAGMGFFTDAYDLFCISMVTKLLGRLYY--HhdgaLKpGSLPPNVSAAVNGVAFCGT 80  tomato
BAA20522  11 ALDVAKTQWY-------HFTAIVIAGMGFFTDAYDLFCISLVTKLLGRIYY--HvdgaVKpGTLPPNVSAAVNGVAFCGT 81  Madagascar periwinkle
BAA33769  38 ALAEIDKAPFgw----yHVRACIVAGVGFFTDSYDIFCVSMLTIMLGIVYYp------GK-GKLPTSSDNAIKLSTSAGT 106 Fusarium graminearum
AAA74899  34 ALAEVDRAPFgw----yHVRAVAVAGVGFFTDSYDIFTVSLLTLMLGIVYFq------AK-ARCLQPP---TQPSSSQHR 99  Neurospora crassa
P25297    49 ALESIDDEGFgw----qQVKTISIAGVGFLTDSYDIFAINLGITMMSYVYWh------GS-MPGPSQT--LLKVSTSVGT 115 Saccharomyces cerev...
AAC49132  17 ALKEIDDAKFgw----qHIRACLVAGTGFFMDAYDLFAVNFASTMIGYVYYg------GK-TPANIDLG--LKVTGSIGT 83  Glomus versiforme
CAB68656  27 VEEGAQERRYylgltkrEFKLMMLAGVGFFLDSYDLFIINLVTPIFEYLYWggIekgpTGkGHYPSGIRGLVNASANIGN 106 fission yeast
AAB81347  81 LAGQLFFGWLGDKLGRKKVYGLTLILMVVCSVASGLSFG--SSPKSVMATLCFFRFWLGFGIGGDYPLSA--TIMSEYAN 156 barrel medic
CAA74607  81 LAGQLFFGWLGDKMGRKKVYGMTLMIMVICSIASGLSFG--HTPKGVMTTLCFFRFWLGFGIGGDYPLSA--TIMSEYAN 156 tomato
BAA20522  82 LAGQLFFGWLGDKMGRKRVYGMTLMLMVIASIASGLSFG--DKPKAVMATLCFFRFWLGFGIGGDYPLSA--TIMSEYAN 157 Madagascar periwinkle
BAA33769 107 VIGQFGFGMLADIVGRKRMYGLELIVTIFATLAQALTAG--SPSTSLVGLIIFWRVIMGVGIGGDYPLSS--IITSEFAT 182 Fusarium graminearum
AAA74899 100 PARSLGRSASAPLLMSLVVRACTDWNCCSSSLPLSLRPW--LRVTFHQHHRYHYLLACSYGGRYRWRLSSfqYITSEFAT 177 Neurospora crassa
P25297   116 VIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAH--SPAINFVAVLTFYRIVMGIGIGGDYPLSS--IITSEFAT 191 Saccharomyces cerev...
AAC49132  84 LLGQLFFGYLADRLGRKRMYGVELMIIIVATVASALSGE--SRAVTVVGTIMFWRVIMGVGIGGDYPLSA--IITSEFAT 159 Glomus versiforme
CAB68656 107 IFGQLLFGFMGDFFGRKFVYGKEMVIVIIATVLVIAMPKsiHSPLSKMMWVFCWRWLLGVGIGGDYPMSA--AITSERSK 184 fission yeast
AAB81347 157 KKTRGAFIAAVFAMQGFGILGGGIVALTVASIFDHKYKVPTFEENPAASl-------LVPQFDYVWRLILMFG------- 222 barrel medic
CAA74607 157 KKTRGAFIAAVFAMQGFGILAGGMVAIIVSAAFKGAFPAPAYEVDAIGS--------TVPQADFVWRIILMFG------- 221 tomato
BAA20522 158 KKTRGAFIAAVFAMQGFGILAGGMVAIIVSASFKAGFPAPAYQDGAVAS--------TVPEADYVWRIILMFG------- 222 Madagascar periwinkle
BAA33769 183 TKWRGAMMAAVFAMQGIGQLVAALVMMFLTLGFKSSLEQAADTKSCTGD--------CQIAVDKMWRTLVGFG------- 247 Fusarium graminearum
AAA74899 178 TKWRGAMMGAVFAMQGLGQLAAAFVMLFVTLGFKKSLEAAPTLASCTGD--------CAVAVDKMWRTVIGVG------- 242 Neurospora crassa
P25297   192 TKWRGAIMGAVFANQAWGQISGGIIALILVAAYKGELEYANSGAECDAR--------CQKACDQMWRILIGLG------- 256 Saccharomyces cerev...
AAC49132 160 KKRRGAMMASVFAMQGFGILGSAIVALAVLAGFRN--EIIKDVS----------------AVDYCWRIVLGCG------- 214 Glomus versiforme
CAB68656 185 IKRRGTLISLIFAFQGFGTLAGAIVTIILLGCFEHPLNREGHYHKLEGVwrlqfglaLVPAIGVLIPRLIMKEsksyens 264 fission yeast
AAB81347 223 -----ALPAALTYYWRMKMPETARYTALVAKNAKQAAADMSKVLQVELEVEEEK------VEKMTSDKR---------NS 282 barrel medic
CAA74607 222 -----AIPAGLTYYWRMKMPETARYTALVAKNLKQAANDMSKVLQVEIEAEPEK------VTAISEAKGa--------ND 282 tomato
BAA20522 223 -----AIPAALTYYWRMKMPETARYTALVAKNAKQAANDMSKVLQVELEAEQEK------VEKFAQEPA---------NT 282 Madagascar periwinkle
BAA33769 248 -----AVPACIALYYRLTIPETPRYTFDVARDVEQADEDVKAYINGKSEGNTDEvtraqnLQSAKTNLEvp-----kaSW 317 Fusarium graminearum
AAA74899 243 -----AVPGCIALYYRLTIPETPRYTFDVKRDVEQASDDIEAFKTGKPKGQPDEatrivaKQEAEKEMEip-----kaSW 312 Neurospora crassa
P25297   257 -----TVLGLACLYFRLTIPESPRYQLDVNAKLELAAAAQEQDGEKKIHDTSDEdmaingLERASTAVEsldnhppkaSF 331 Saccharomyces cerev...
AAC49132 215 -----AVPGLAALYFRLTIPETPRYTMDVEHDVNKATSDITSYLQKNDVNEDD--------TNTGNHVGvp-----kaSW 276 Glomus versiforme
CAB68656 265 kalnsAEGKDPKAFFNTDDEDNMKKSSSHGDSEVVEASDRYANQADAADAEVDN------IEKQFAAVTtp------eNS 332 fission yeast
AAB81347 283 YGLFSKQFAARHGLALFGTCSTWFLLDIAFYSQNLFQKDIFSAIGWIPPAKEMN---AIHEVYKIARAQTLIALCSTVPG 359 barrel medic
CAA74607 283 FGLFTKEFLRRHGLHLLGTASTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMN---ALEEVYKIARAQTLIALCSTVPG 359 tomato
BAA20522 283 FGLFTKEFLKRHGLHLLGTATTWFLLDIAFYSQNLFQKDIFSAIGWIPPAQTMN---AIEEVFRIARAQTLIALCSTVPG 359 Madagascar periwinkle
BAA33769 318 RDFFQHYSKWKNASLLLGTAGSWFCLDVAFYGLSLNNGTILKVIGYSTKDATNV----YEFLHNTAVGNIIIVLAGAVPG 393 Fusarium graminearum
AAA74899 313 GDFFRHYSKRKNAMLLAGTALSWCFLDIAYYGVSLNNATILNVIGYSTTGAKNT----YEILYNTAVGNLIIVLAGAVPG 388 Neurospora crassa
P25297   332 KDFCRHFGQWKYGKILLGTAGSWFTLDVAFYGLSLNSAVILQTIGY--AGSKNV----YKKLYDTAVGNLILICAGSLPG 405 Saccharomyces cerev...
AAC49132 277 SDFVSYFGKWSNGKVLLGTSMSWFALDIAFYGIGLNNGIILSAIGYSETHEADLnlrAYNSLKNMAVGNIIITIMGTAPG 356 Glomus versiforme
CAB68656 333 SGFITYFRQWRHFKHLLGTSVCWFLLDIAFYGVNLNQSVILKNIGFS---TGTN---EYRTLMKNAIGNLIIAVAGYVPG 406 fission yeast
AAB81347 360 YWFTVAFIDHMGRFAIQMMGFFFMTVFMFALAIPYDHWSKEenriGFVVIYSLTFFFANFGPNATTFVVPAEIFPARLRS 439 barrel medic
CAA74607 360 YWFTVAFIDKIGRFAIQLMGFFFMTVFMFALAIPYHHWTLKdhriGFVVMYSFTFFFANFGPNATTFVVPAEIFPARLRS 439 tomato
BAA20522 360 YWFTVFLIDRIGRFIIQWMGFFFMTVFMFALAIPYNHWTHKdnriGFVIMYSLTFFFANFGPNATTFVVPAEIFPARLRS 439 Madagascar periwinkle
BAA33769 394 YWVSVATIDTLGRKTIQLGGFIILTILFIVMGFAYNHIPSN----GLLAIYVLAQFFFNFGPNTTTFIVPGEVFPTRYRS 469 Fusarium graminearum
AAA74899 389 YWVTVFTVDTVGRKPIQFMGFGILTILFVVMGFAYKHLSPH----ALLAIFVLAQFFFNFGPNATTFIVPGEVFPTRYRS 464 Neurospora crassa
P25297   406 YWVSVFTVDIIGRKPIQLAGFIILTALFCVIGFAYHKLGDH----GLLALYVICQFFQNFGPNTTTFIVPGECFPTRYRS 481 Saccharomyces cerev...
AAC49132 357 YWVTAALVDSWGRKPIQLMGFGVLTALFIVMGAAFNPLKEHsi-pAFIILFTLLQFFQNFGPNTTTFIVPGEVFPTRYRS 435 Glomus versiforme
CAB68656 407 YWFNVFLVEILGRKWIQLQGFVITGLMFAILAGRWNEISTG----GRFACFVIAQLFSNFGPNSTTFIYPAEVFPARVRG 482 fission yeast
AAB81347 440 TCHGISAAAGKAGAIVGAFGFLYAAQSKDPTKtdkGYPTGIGIKNSLIMLGVINFVGMLCTLLVPESKGKSLEELSGE 517 barrel medic
CAA74607 440 TCHGISAAAGKAGAMVGAFGFLYAAQPTDPTKtdaGYPPGHWCEELVDRPWLCNFLGMLFTFLVPESNGKSLEDLSRE 517 tomato
BAA20522 440 TCHGISAAAGKAGAIIGAFGFLYAAQPSDPSKtdkGYPPGIGVKNALIVLGCVNFLGMVFTFLVPEAKGKSLEEVSKE 517 Madagascar periwinkle
BAA33769 470 TSHGISAASGKIGSIIGQGAISILRTHGATDK----NEA-PWMDHVLEIYALFMLLGIFTTLLIPETARKTLEELSGE 542 Fusarium graminearum
AAA74899 465 TSHGLSAAMGKIGSIIGQGAIAPLRTRGAVKG---GNPN-PWMNHVLEIYALFMLLGVGTTFLIPETKRKTLEELSGE 538 Neurospora crassa
P25297   482 TAHGISAASGKVGAIIAQTALGTLIDHNCARD---GKPTNCWLPHVMEIFALFMLLGIFTTLLIPETKRKTLEEIN-E 555 Saccharomyces cerevis...
AAC49132 436 TGHGISAASGKLGAIVAQVGFSKLKDIGGSN---------AFVGPLLLIFSAWMFIGGLFSILIPETKGLSLEELANE 504 Glomus versiforme
CAB68656 483 TAHGVSAALGKCGAILASLLFNFLTG-------------VIGYGNVMWIFCGCMWGGILFTLLLPETKGRDADEIDRL 547 fission yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap