Conserved Protein Domain Family

TIGR00876: tal_mycobact 
transaldolase, mycobacterial type
This model describes one of three related but easily separable famiiles of known and putative transaldolases. This family and the family typified by E. coli TalA and TalB both contain experimentally verified examples. [Energy metabolism, Pentose phosphate pathway]
PSSM-Id: 129954
Aligned: 2 rows
Threshold Bit Score: 525.839
Threshold Setting Gi: 2501348
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O06812 174 RYREVMDAYLTGMEKArqaghslskihSVASFFVSRVDTEIDKRLDRIgsrqaleLRGQAGVANArlayatyrevfedSD 253 Mycobacterium tubercu...
P56108 158 IAGEIAQILAKEAQKR-----------AVISVFVSRFDKEIDPLVPKN-------LQAQSGIINA-------------TE 206 Helicobacter pylori 2...
O06812 334 IGIDLTDVFAVLEEEGVRKFEASWNELLQE 363 Mycobacterium tuberculosis
P56108 286 HNIDLENTAQKLLKEGLIAFKQSFEKLLSS 315 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap