Conserved Protein Domain Family
fsa_talC_mipB

?
TIGR00875: fsa_talC_mipB 
fructose-6-phosphate aldolase, TalC/MipB family
This model represents a family that includes the E. coli transaldolase homologs TalC and MipB, both shown to be fructose-6-phosphate aldolases rather than transaldolases as previously thought. It is related to but distinct from the transaldolase family of E. coli TalA and TalB. The member from Bacillus subtilis becomes phosphorylated during early stationary phase but not during exponential growth. [Energy metabolism, Pentose phosphate pathway]
Statistics
?
PSSM-Id: 129953
View PSSM: TIGR00875
Aligned: 4 rows
Threshold Bit Score: 316.032
Threshold Setting Gi: 853766
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P32669     1 MELYLDTANVAEVERLARIFPIAGVTTNPSIIAASK-ESIWEVLPRLQKAIgdEGILFAQTMSRDAQGMVEEAKRLRDAI 79  Escherichia coli K-12
O66520     1 MKFFLDTANVEEIKKAMEWGILDGVTTNPTLISKTG-RPFKEVVKEILELV--DGPVSLETVSLDAEGMIREGRMLAELG 77  Aquifex aeolicus VF5
Q58370     1 MKFFLDTANVEEIKKYAELGLVDGVTTNPTLVAKEG-RDFYEVVKEICEIV--EGPVSAEVISTDAEGMVKEARELAKLA 77  Methanocaldococcus ...
CAA89874   1 MLFFVDTANIDEIREANELGILAGVTTNPSLVAKEAnVSFHDRLREITDVV--KGSVSAEVISLKAEEMIEEGKELAKIA 78  Bacillus subtilis s...
P32669    80 PGIVVKIPVTSEGLAAIKILKKEGITTLGTAVYSAAQGLLAALAGAKYVAPYVNRVDAQGGDGIRTVQELQTLLEMHAPE 159 Escherichia coli K-12
O66520    78 ENVVVKIPMTPEGLKAVIALESEGIPTNVTLVFSPTQALLAAKAGASYVSPFVGRLDDISGEGMKLIEEIKTIFSNYEFD 157 Aquifex aeolicus VF5
Q58370    78 DNIVIKIPMTKDGMKAVKILSAEGIKTNVTLVFSPLQALVAAKAGATYVSPFVGRLDDIGHVGMKLIEDVVKIYKNYDIK 157 Methanocaldococcus ...
CAA89874  79 PNITVKIPMTSDGLKAVRALTGLGIKTNVTLIFNANQALLAARAGATYVSPFLGRLDDIGHNGLDLISEVKQIFDIHGLD 158 Bacillus subtilis s...
P32669   160 SMVLAASFKTPRQALDCLLAGCESITLPLDVAQQMLNTPAVESAIEKFEHDWNAAF 215 Escherichia coli K-12
O66520   158 TEIIVASVRHPMHVLESALIGADICTMPFKVMEQLFKHPLTDIGLERFLKDWEKVP 213 Aquifex aeolicus VF5
Q58370   158 TEVIVASVRHPWHVLEAAKIGADIATMPPAVMDKLFNHPLTDIGLERFLKDWDEYL 213 Methanocaldococcus jannaschii DSM 2661
CAA89874 159 TQIIAASIRHPQHVTEAALRGAHTAQCR---------------------------- 186 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap