3CQ0


Conserved Protein Domain Family
talAB

?
TIGR00874: talAB 
Click on image for an interactive view with Cn3D
transaldolase
This family includes the majority of known and predicted transaldolase sequences, including E. coli TalA and TalB. It excluded two other families. The first includes E. coli transaldolase-like protein TalC. The second family includes the putative transaldolases of Helicobacter pylori and Mycobacterium tuberculosis. [Energy metabolism, Pentose phosphate pathway]
Statistics
?
PSSM-Id: 162081
View PSSM: TIGR00874
Aligned: 9 rows
Threshold Bit Score: 533.956
Threshold Setting Gi: 1729825
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CQ0_A        14 SSLEQLKKAgTHVVADSGDFEAISKYEPQDSTTNPSLILAASKLEKYARFIDAAVEYGRKHGKTDH---EKIENAMDKIL 90  baker's yeast
P53228        14 SSLEQLKKAgTHVVADSGDFEAISKYEPQDSTTNPSLILAASKLEKYARFIDAAVEYGRKHGKTDH---EKIENAMDKIL 90  Saccharomyces c...
P78258         2 NELDGIKQF-TTVVADSGDIESIRHYHPQDATTNPSLLLKAAGLSQYEHLIDDAIAWGKKNGKTQE---QQVVAACDKLA 77  Escherichia coli
P72797         4 NLLEQLRQF-TVVVADTGDIQAIETFTPRDSTTNPSLITAAAQMPQYQEIVDSTLLKAKDEAGENAsikDIVRLAFDRLA 82  Synechocystis s...
Q9Z998         3 NQFDQLKKL-STIVCDSGDPELVKASGSQDATTNPSLILKVAQEPKFQELLNEAVVWGIRQNGDDL---QTLSFILDKIQ 78  Chlamydia pneum...
O84315         3 SQFDQLKLW-SVLVGDTGDPALIKTLGVQDATTNPSLILKVAQEPKYQSMLTEAISWGIRQNGDDV---QTLTFVLDKIQ 78  Chlamydia trach...
WP_005013191  57 DKLTSLRQY-TTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPEYRKLIDDAVAWAKQQSNDRA---QQIVDATDKLA 132 Shigella dysent...
WP_005693444   3 TQLDSLRNM-TVVVADTGDIDAIKKYQPQDATTNPSLILSASALPQYAPLIDEAVAYAKAQSADKA---QQLIDAEDKLA 78  Haemophilus inf...
P15019        14 NSLEQLKASgTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTYAKLIDVAVEYGKKHGKTTE---EQVENAVDRLL 90  Saccharomyces c...
3CQ0_A        91 VEFGTQILKVVPGRVSTEVDARLSFDKKATVKKALHIIKLYKDAGVPKERVLIKIASTWEGIQAARELEvKHGIHCNMTL 170 baker's yeast
P53228        91 VEFGTQILKVVPGRVSTEVDARLSFDKKATVKKALHIIKLYKDAGVPKERVLIKIASTWEGIQAARELEvKHGIHCNMTL 170 Saccharomyces c...
P78258        78 VNFGAEILKIVPGRVSTEVDARLSFDKEKSIEKARHLVDLYQQQGVEKSRILIKLASTWEGIRAAEELE-KEGINCNLTL 156 Escherichia coli
P72797        83 VAFGLKILQIIPGRVSTEVDARLSYDTEATIAKARYLIGEYAKAGIDKKRILIKIASTWEGIKAAEVLE-QEGIHCNLTL 161 Synechocystis s...
Q9Z998        79 VNFALEIIKNIPGRISLEIDARLSFNVEAMVQRAVFLSQLFEAMGGDKKRLLVKIPGTWEGIRAVEFLE-AKGIACNVTL 157 Chlamydia pneum...
O84315        79 VNLGLEILKHVPGRVSLEIDARLSFNTEAMVQRAIFLSQLFEKMGGDKKRLLVKIPGTWEGICAAEVLE-SQGIACNVTL 157 Chlamydia trach...
WP_005013191 133 VNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLE-KEGINCNLTL 211 Shigella dysent...
WP_005693444  79 VNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIALYNAAGISNDRILIKIASTWQGIRAAEILE-KEGINCNLTL 157 Haemophilus inf...
P15019        91 VEFGKEILKIVPGRVSTEVDARLSFDTQATIEKARHIIKLFEQEGVSKERVLIKIASTWEGIQAAKELEeKDGIHCNLTL 170 Saccharomyces c...
3CQ0_A       171 LFSFTQAVACAEANVTLISPFVGRIMDFYKALSG-KDYTAETDPGVLSVKKIYSYYKRHGYATEVMAASFRNLDELKALA 249 baker's yeast
P53228       171 LFSFTQAVACAEANVTLISPFVGRIMDFYKALSG-KDYTAETDPGVLSVKKIYSYYKRHGYATEVMAASFRNLDELKALA 249 Saccharomyces c...
P78258       157 LFSFAQARACAEAGVFLISPFVGRIYDWYQARKPmDPYVVEEDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQILALT 236 Escherichia coli
P72797       162 LFGLHQAIACAEAKVTLISPFVGRILDWYKKSTG-KEYDSHEDPGVQSVTTIYNYYKRFGYKTEVMGASFRNIGEIIELA 240 Synechocystis s...
Q9Z998       158 IFNLVQAIAAAKAKATLISPFVGRIYDWWIAAYGdEGYSIDADPGVASVSNIYAYYKKFGIPTQIMAASFRTKEQVLALA 237 Chlamydia pneum...
O84315       158 IFNLVQAIAAAKAKVTLVSPFVGRIYDWWIAAYGaEGYSIEADPGVASVANIYSYYKKFDIPTQIMAASFRTKEQVLALA 237 Chlamydia trach...
WP_005013191 212 LFSFAQARACAEAGVFLISPFVGRILDWYKANTDkKEYAPAEDPGVVSVSEIYQYYKEHGYETVVMGASFRNIGEILELA 291 Shigella dysent...
WP_005693444 158 LFSEAQARACAEAGVYLISPFVGRILDWYKANSDkKEYAPAEDPGVISVTKIYNYYKEYGYNTVVMGASFRNVGEITELA 237 Haemophilus inf...
P15019       171 LFSFVQAVACAEAQVTLISPFVGRILDWYKSSTG-KDYKGEADPGVISVKKIYNYYKKYGYKTIVMGASFRSTDEIKNLA 249 Saccharomyces c...
3CQ0_A       250 GIDNMTLPLNLLEQLYESTDPIENKLNSESAKEegVEKVSFINDEPHFRYVLNEDQMATEKLSDGIRKFSADIEALYKLV 329 baker's yeast
P53228       250 GIDNMTLPLNLLEQLYESTDPIENKLNSESAKEegVEKVSFINDEPHFRYVLNEDQMATEKLSDGIRKFSADIEALYKLV 329 Saccharomyces c...
P78258       237 GCDRLTIAPNLLKELQEKVSPVVRKLIPPSQ----TFPRPAPMSEAEFRWEHNQDAMAVEKLSEGIRLFAVDQRKLEDLL 312 Escherichia coli
P72797       241 GCDLLTISPQLLDQLRNTEGDLPRKLDPATVP---QDIEKIVMDKATFDKMHAEDPMASEKLAEGIAGFTKALEVLEHLL 317 Synechocystis s...
Q9Z998       238 GCDLLTISPKLLDELKKSQHPVKKELDPAEAKK--LDVQPIELTESFFRFLMNEDAMATEKLAEGIRIFAGDTQILETAI 315 Chlamydia pneum...
O84315       238 GCDFLTISPKLLEELKKDQQPVERKLSVEEAKK--LDIQPVELSESVFRFLMNEDAMATEKLAEGIRIFSGDTQILESAV 315 Chlamydia trach...
WP_005013191 292 GCDRLTIAPALLKELAESEGAIERKLSYTGE----VKARPARITESEFLWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMI 367 Shigella dysent...
WP_005693444 238 GCDRLTIAPALLKELQENSTALVRKLEYKGE----VKAKPQPLTEAEFYWQHNSDAMAVEKLAEGIRKFAIDQEKLETML 313 Haemophilus inf...
P15019       250 GVDYLTISPALLDKLMNSTEPFPRVLDPVSAKKeaGDKISYISDESKFRFDLNEDAMATEKLSEGIRKFSADIVTLFDLI 329 Saccharomyces c...
3CQ0_A       330 EEKM 333 baker's yeast
P53228       330 EEKM 333 Saccharomyces cerevisiae S288c
P78258       313 AAKL 316 Escherichia coli
P72797       318 EERL 321 Synechocystis sp. PCC 6803 substr. Kazusa
Q9Z998       316 TEFI 319 Chlamydia pneumoniae
O84315       316 TEFI 319 Chlamydia trachomatis D/UW-3/CX
WP_005013191 368 GDLL 371 Shigella dysenteriae
WP_005693444 314 SAKL 317 Haemophilus influenzae
P15019       330 EKKV 333 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap