Conserved Protein Domain Family
hCaCC

?
TIGR00868: hCaCC 
calcium-activated chloride channel protein 1
found a row in 1A13.INFO that was not parsed out AC found a row in 1A13.INFO that was not parsed out EC found a row in 1A13.INFO that was not parsed out GA found a row in 1A13.INFO that was not parsed out SO found a row in 1A13.INFO that was not parsed out RH found a row in 1A13.INFO that was not parsed out EN found a row in 1A13.INFO that was not parsed out GS found a row in 1A13.INFO that was not parsed out AL found a row in 1A13.INFO that was not parsed out The Epithelial Chloride Channel (E-ClC) Family (TC 1.A.13) found a row in 1A13.INFO that was not parsed out found a row in 1A13.INFO that was not parsed out Mammals have multiple isoforms of epithelial chloride channel proteins. The first member of this family to be characterized was a respiratory epithelium, Ca found a row in 1A13.INFO that was not parsed out 2+-regulated, chloride channel protein isolated from bovine tracheal apical membranes. It was biochemically characterized as a 140 kDa complex. The purified found a row in 1A13.INFO that was not parsed out complex when reconstituted in a planar lipid bilayer behaved as an anion-selective channel. It was regulated by Ca 2+ via a calmodulin kinase II-dependent found a row in 1A13.INFO that was not parsed out mechanism. When the cRNA was injected into Xenopus oocytes, an outward rectifying, DIDS-sensitive, anion conductance was measured. A related gene, found a row in 1A13.INFO that was not parsed out Lu-ECAM, was cloned from the bovine aortic endothelial cell line, BAEC. It is expressed in the lung and spleen but not in the trachea. Homologues are found in found a row in 1A13.INFO that was not parsed out several mammals, and at least three paralogues(hCaCC-1-3) are present in humans, each with different tissue distributions. found a row in 1A13.INFO that was not parsed out [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 129946
View PSSM: TIGR00868
Aligned: 4 rows
Threshold Bit Score: 1665.79
Threshold Setting Gi: 5726289
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P54281     1 MVPRLTVILFLTLHLLPGMK-SSMVNLINNGYDGIVIAINPSVPEDEKLIQNIKEMVTEASTYLFHATKRRVYFRNVSIL 79  cattle
AAF00077   1 MGSFRSSLFILVLHLLEGAQsNSLIQLNGNGYEGIVIAIDPNVPEDERLIQNIKDMVTKASPYLFEATEKRFYFKNVAIL 80  pig
AAD48398   1 MGLFRGFVFLLVLCLLHQSN-TSFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTASTYLFEATEKRFFFKNVSIL 79  human
AAC35003   1 MVPGLQVLLFLTLHLLQNTE-SSMVHLNSNGYEGVVIAINPSVPEDERLIPSIKEMVTQASTYLFEASQGRVYFRNISIL 79  house mouse
P54281    80 IPMTWKSKSEYLMPKQESYDQAEVIVANPYLKHGDDPYTLQYGRCGEKGQYIHFTPNFLLTNNLPIYGSRGRAFVHEWAH 159 cattle
AAF00077  81 IPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAH 160 pig
AAD48398  80 IPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAH 159 human
AAC35003  80 VPMTWKSKPEYLMPKRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAH 159 house mouse
P54281   160 LRWGIFDEYNGDQPFYISrRNTIEATRCSTHITGTNVIVKCQGGSCITRPCRRDSQTGLYEAKCTFIPEKSQTARESIMF 239 cattle
AAF00077 161 LRWGVFNEYNNEQKFYLS-NKKEQPVICSAAIRGTNVLPQCQGGSCVTKPCRADRVTGLFQKECEFIPDPQQSEKASIMF 239 pig
AAD48398 160 LRWGVFDEYNEDQPFYRAkSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQTEKASIMF 239 human
AAC35003 160 LRWGVFDEYNVDQPFYMSrKNTIEATRCSTRITGTNVVHNCERGNCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMF 239 house mouse
P54281   240 MQSLHSVTEFCTEKTHNVEAPNLQNKMCNGKSTWDVIMNSTDFQNTSPMTEMnpPTQPTFSLLKSKQRVVCLVLDKSGSM 319 cattle
AAF00077 240 AQSIDTVVEFCKEKNHNKEAPNDQNQKCNLRSTWEVIQDSEDFKKTTPMTTQ--PPAPTFSLLQIGQRIVCLVLDKSGSM 317 pig
AAD48398 240 MQSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTIPMVTP--PPPPVFSLLKIRQRIVCLVLDKSGSM 317 human
AAC35003 240 MQNLNSVVEFCTEKNHNAEAPNLQNKMCNRRSTWDVIKTSADFQNAPPMRGTeaPPPPTFSLLKSRRRVVCLVLDKSGSM 319 house mouse
P54281   320 SSEDRLFRMNQAAELFLIQIIEKGSLVGMVTFDSVAEIRNNLTKITDDNVYENITANLPQEANGGTSICRGLKAGFQAII 399 cattle
AAF00077 318 TVGGRLKRLNQAGKLFLLQTVEQGAWVGMVAFDSAAYVKSELVQINSAAERDALARSLPTAASGGTSICSGLRSAFTVIK 397 pig
AAD48398 318 GGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTATIVNKLIQIKSSDERNTLMAGLPTYPLGGTSICSGIKYAFQVIG 397 human
AAC35003 320 DKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAAHIQNYLIKITSSSDYQKITANLPQQASGGTSICHGLQAGFQAIT 399 house mouse
P54281   400 QSQQsTSGSEIILLTDGEDNEIHSCIEEVKQSGVIIHTIALGPSAAKELETLSDMTGGHRFYAN--KDINGLTNAFSRIS 477 cattle
AAF00077 398 KKYP-TDGSEIVLLTDGEDNTISACFPEVKQNGAIIHTVALGPSAAKELEELSQMTGGLQTYASdqAENNGLIDAFGALS 476 pig
AAD48398 398 ELHSqLDGSEVLLLTDGEDNTASSCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSdeAQNNGLIDAFGALT 477 human
AAC35003 400 SSDQsTSGSEIVLLTDGEDNGIRSCFEAVSRSGAIIHTIALGPSAARELETLSDMTGGLRFYAN--KDLNSLIDAFSRIS 477 house mouse
P54281   478 SRSGSITQQTIQLESKALAITEKKWVNGTVPVDSTIGNDTFFVVTWT--IKKPEILLQDPKGKkyKTSDFKEDKLNiHSA 555 cattle
AAF00077 477 SGNRAASQRSIQLESQGLTLQNNEWMNGTVVVDSTVGKDTLFLITLErkFLSPIPFFGVPSGR--SQDSFLVGKHN-KMA 553 pig
AAD48398 478 SGNTDLSQKSLQLESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWN--SLPPSISLWDPSGT--IMENFTVDATS-KMA 552 human
AAC35003 478 STSGSVSQQALQLESKAFDVRAGAWINGTVPLDSTVGNDTFFVITWM--VKKPEIILQDPKGKkyTTSDFQDDKLNiRSA 555 house mouse
P54281   556 RLRIPGIAETGTWTYSLLNNhAspQILTVTVTTRARSPTTPPVTATAHMSQNTAHYPSPVIVYAQVSQGFLPVLGINVTA 635 cattle
AAF00077 554 YFQVPGTAKVGMWKYSLQAS-S--QTLTLTVSSRRSSATLPPVTVTSKMNKDTGKFPSPMVVYTKIHQGTLPILRAKVTA 630 pig
AAD48398 553 YLSIPGTAKVGTWAYNLQAK-AnpETLTITVTSRAANSSVPPITVNAKMNKDVNSFPSPMIVYAEILQGYVPVLGANVTA 631 human
AAC35003 556 RLQIPGTAETGTWTYSITG--TksQLITMTVTTRARSPTMEPLLATAHMSQSTAQYPSRMIVYARVSQGFLPVLGANVTA 633 house mouse
P54281   636 IIETEDGHQVTLELWDNGAGADTVKNDGIYSRYFTDYRGNGRYSLKVHAEARNNTARLSLRQPQNKALYIPGYIENGKII 715 cattle
AAF00077 631 LIESENGKTVTLELLDNGAGADATKNDGIYSRYFTAYDANGRYSVKVWALGGVNTPRRRAPPLWSGAMYIRGWIENGEIK 710 pig
AAD48398 632 FIESQNGHTEVLELLDNGAGADSFKNDGVYSRYFTAYTENGRYSLKVRAHGGANTARLKLRPPLNRAAYIPGWVVNGEIE 711 human
AAC35003 634 LIEAEHGHQVTLELWDNGAGADTVKNDGIYTRYFTDYHGNSRYSLKVRVQAQRNKTRLSLRQ-KNKSLYIPGYVENGKIV 712 house mouse
P54281   716 LNPPRPEVKDDLAKAEIEDFSRLTSGGSFTVSGAPP-GNHPSVLPPNKIIDLEAKFKEDHIQ-LSWTAPANVLDKGKANS 793 cattle
AAF00077 711 WNPPRPDINKDDLQGKQVCFSRTASGGSFVASDVPK-SPIPDLFPPCKITDLKAGIQGDNLInLTWTAPGDDYDHGRADR 789 pig
AAD48398 712 ANPPRPEID-EDTQTTLEDFSRTASGGAFVVSQVPS-LPLPDQYPPSQITDLDATVHEDKII-LTWTAPGDNFDVGKVQR 788 human
AAC35003 713 LNPPRPDVQEEAIEATVEDFNRVTSGGSFTVSGAPPdGDHARVFPPSKVTDLEAEFIGDYIH-LTWTAPGKVLDNGRAHR 791 house mouse
P54281   794 YIIRISKSFLDLQKDFDNATLVNTSSLKPKEAGSDENFEFKPEPFRIENGTNFYIAVQAINEANLTSEVSNIAQ 867 cattle
AAF00077 790 YIIRISTNILDLRDKFNDSVQVNTTDLIPKEANSEEVFVFKPEGIPFTNGTDLFIAVQAVDKTNLKSEISNIAQ 863 pig
AAD48398 789 YIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATHIFIAIKSIDKSNLTSKVSNIAQ 862 human
AAC35003 792 YIIRMSQHPLDLQEDFNNATLVNASSLIPKEAGSKETFKFKPETFKIANGIQLYIAIQADNEASLTSEVSNIAQ 865 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap