2D2Z,1RK4,2PER


Conserved Protein Domain Family
O-ClC

?
TIGR00862: O-ClC 
Click on image for an interactive view with Cn3D
intracellular chloride channel protein
The Organellar Chloride Channel (O-ClC) Family (TC 1.A.12) Proteins of the O-ClC family are voltage-sensitive chloride channels found in intracellular membranes but not the plasma membranes of animal cells. They are found in human nuclear membranes, and the bovine protein targets to the microsomes, but not the plasma membrane, when expressed in Xenopus laevis oocytes. These proteins are thought to function in the regulation of the membrane potential and in transepithelial ion absorption and secretion in the kidney. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 129941
View PSSM: TIGR00862
Aligned: 7 rows
Threshold Bit Score: 443.533
Threshold Setting Gi: 85681058
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D2Z_A  17 PLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLE 96  human
Q9Z0W7  17 PLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPAHLQNLAPGTHPPFITFNSEVKTDVNKIEEFLE 96  Norway rat
O15247  12 PEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLE 91  human
Q9Z1Q5   6 PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLE 85  house mouse
P35526 199 PEINLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLE 278 cattle
1RK4_A   8 PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLE 87  human
2PER_A  32 PEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLE 111 human
2D2Z_A  97 EVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENS-MEDIKFST 175 human
Q9Z0W7  97 EVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGEIDENS-MEDIKSST 175 Norway rat
O15247  92 QTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDS-AEEPPVSR 170 human
Q9Z1Q5  86 AMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETS-AEDEGISQ 164 house mouse
P35526 279 ETLTPEKYPRLAAKHRESNTAGIDIFVKFSAYIKNTKQQSNAALERGLTKALKKLDDYLNTPLPEEIDADTrGDDEKGSR 358 cattle
1RK4_A  88 AVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETS-AEDEGVSQ 166 human
2PER_A 112 QTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDS-AEEPPVSR 190 human
2D2Z_A 176 RKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLT 252 human
Q9Z0W7 176 RRFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLT 252 Norway rat
O15247 171 RLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAkqks 247 human
Q9Z1Q5 165 RKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVARALK 241 house mouse
P35526 359 RKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLS 435 cattle
1RK4_A 167 RKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK 243 human
2PER_A 191 RLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQks 267 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap