1XGE


Conserved Protein Domain Family
pyrC_dimer

?
TIGR00856: pyrC_dimer 
Click on image for an interactive view with Cn3D
dihydroorotase, homodimeric type
This homodimeric form of dihydroorotase is less common in microbial genomes than a related dihydroorotase that appears in a complex with aspartyltranscarbamoylase or as a homologous domain in multifunctional proteins of pyrimidine biosynthesis in higher eukaryotes. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 129935
View PSSM: TIGR00856
Aligned: 5 rows
Threshold Bit Score: 516.676
Threshold Setting Gi: 3024493
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XGE_A         6 VLKIRRPDDWHLHLRDGDMLKTVVPYTSEI-YGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAghdFTPLMTCYLTDSL 84  Escherichia coli
P20051         4 EIDLGLTCDMHVHVREGAMCELVTPKIRDGgVSIAYIMPNLQPPITTLDRVIEYKKTLQKLAPK---TTFLMSFYLSKDL 80  Saccharomyces c...
P74438         3 KLTITRPDDWHLHLRDGAALKAVLPHTVRQ-FARAIVMPNLKPPVRSVADAAAYRERILAAIPAggqFEPLMTLYLTDNT 81  Synechocystis s...
WP_000126534   7 VLKIRRPDDWHLHLRDGDMLKTVVPYTSEI-YGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAghdFTPLMTCYLTDSL 85  Enterobacteriaceae
P56465         2 EITLFDPIDAHLHVRENALLKAVLGYSSEP-FSAAVIMPNLSKPLIDTPTTLEYEEEILNHSSN---FKPLMSLYFNDGL 77  Helicobacter py...
1XGE_A        85 DPNELERGFNEgVFTAAXLYPANATTNSSHGVTS--VDAIMPVLERMEKIGMPLLVHGEVTh---Ad---iDIFDREARF 156 Escherichia coli
P20051        81 TPDLIHEAAQQhAIRGVKCYPAGVTTNSAAGVDPndFSAFYPIFKAMQEENLVLNLHGEKPsvhdGdkepiHVLNAEEAF 160 Saccharomyces c...
P74438        82 NPEEIIAAKASqFVKAVKYYPAGATTNSDFGVTD--IHRCDAVLAAMEQVDLPLLLHGEVTd---Sn---iDIFDREKVF 153 Synechocystis s...
WP_000126534  86 DPNELERGFNEgVFTAAKLYPANATTNSSHGVTS--IDAIMPVLERMEKIGMPLLVHGEVTh---Ad---iDIFDREARF 157 Enterobacteriaceae
P56465        78 TLEELQCAKEK-GVRFLKLYPKGMTTNAQNGTSDllGEKTLEVLENAQKLGFILCIHAEQT----G-----FCLDKEFLC 147 Helicobacter py...
1XGE_A       157 IEsVMEPLRQRLTALKVVFEHITTKDAADYVRDGNEr--------LAATITPQHLMFNRNHMLVggvRPHLYCLPILKRN 228 Escherichia coli
P20051       161 LP-ALKKLHNDFPNLKIILEHCTSESAIKTIEDINKnvkkatdvkVAATLTAHHLFLTIDDWAG---NPVNFCKPVAKLP 236 Saccharomyces c...
P74438       154 IEkYLIPLREKFPRLRVVLEHITTSDAVQFVLSANN---------IAATITPQHLLFSRNALFKggiCPHFYCLPILKRE 224 Synechocystis s...
WP_000126534 158 IEsVMEPLRQRLTALKVVFEHITTKDAADYVRDGNEr--------LAATITPQHLMFNRNHMLVggvRPHLYCLPILKRN 229 Enterobacteriaceae
P56465       148 HS-VLETFALSFPKLKIIIEHLSDWRSIALIEKHDN---------LYATLTLHHISMTLDDLLGgslNPHCFCKPLIKTK 217 Helicobacter py...
1XGE_A       229 IHQQALRELVASGFNRVFLGTDSAPHARHRKESSC-GCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPV 307 Escherichia coli
P20051       237 NDKKALVKAAVSGKPYFFFGSDSAPHPVQNKANYEgVCAGVYSQSFAIPYIAQVFEEQNALENLKGFVSDFGISFYEVKD 316 Saccharomyces c...
P74438       225 EHRLSLLHAATSGNPKFFLGTDSAPHARNSKESLC-GCAGCYSALHAMELYAEAFESVNSLDKLEAFASFYGPDFYQLPR 303 Synechocystis s...
WP_000126534 230 IHQQALRELVASGFNRVFLGTDSAPHARHRKESSC-GCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPV 308 Enterobacteriaceae
P56465       218 KDQERLLSLALKAHPKISFGSDSAPHFISKKHSAN-IPAGIFSAPILLPALCELFEKHNALENLQAFISDNAKTIYGLEN 296 Helicobacter py...
1XGE_A       308 n----DTFIELVREEQQVAESIALTD-DTLVPFLAGETVRWSVK 346 Escherichia coli
P20051       317 sevasSDKAILFKKEQVIPQVISDGKdISIIPFKAGDKLSWSVR 360 Saccharomyces cerevisiae S288c
P74438       304 n----TAQITLMKNPWRIPAELPFPE-SGLVPLRAGEEITWQMV 342 Synechocystis sp. PCC 6803 substr. Kazusa
WP_000126534 309 n----DTFIELVREEQQVAESIALTD-DTLVPFLAGETVRWSVK 347 Enterobacteriaceae
P56465       297 l---pSKKARLSKKPFMIPTHTLCLN-EKIAILRGGETLSWNLQ 336 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap