1NRZ,1BLE,3EYE


Conserved Protein Domain Family
pts-sorbose

?
TIGR00854: pts-sorbose 
Click on image for an interactive view with Cn3D
PTS system, mannose/fructose/sorbose family, IIB component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains.The Man family is unique in several respects among PTS permease families.It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine, N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the IIB components of this family of PTS transporters. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129933
View PSSM: TIGR00854
Aligned: 6 rows
Threshold Bit Score: 211.174
Threshold Setting Gi: 1172733
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NRZ_A     2 QITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPP-GMKVNVVSLEKAVAVYHNPQYQdETVF 80  Klebsiella pneumoniae
P42909     5 NILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETyGFGIRFFTIEKTINVIGKAAPH-QKIF 83  Escherichia coli K-12
AAF81083  15 NIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDPVQQNLMEMVLAE-GIAVRFWTLQKVIDNIHRAADR-QKIL 92  Escherichia coli
P37081     2 QITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPP-GMKVNVVSLEKAVAVYHNPQYQdETVF 80  Klebsiella pneumoniae
1BLE_A     3 NIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPS-NVKASAVSVSKMAKAFHSPRYEgVTAM 81  Bacillus subtilis
3EYE_A     7 NILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETyGFGIRFFTIEKTINVIGKAAPH-QKIF 85  Escherichia coli O1...
1NRZ_A    81 YLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAVSLDPQDIQAFRELDKLGVKLDLRVVASDPSVN 152 Klebsiella pneumoniae
P42909    84 LICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQ 155 Escherichia coli K-12
AAF81083  93 LVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTVSVDAGDIAAFNDLKTAGVECFVQGVPTEPAVD 164 Escherichia coli
P37081    81 YLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAVSLDPQDIQAFRELDKLGVKLDLRVVASDPSVN 152 Klebsiella pneumoniae
1BLE_A    82 LLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKSVSVTEQDIKAFETLSDKGVKLELRQLPSDASED 153 Bacillus subtilis
3EYE_A    86 LICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQ 157 Escherichia coli O157:H7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap