Conserved Protein Domain Family
mtlA

?
TIGR00851: mtlA 
PTS system, mannitol-specific IIC component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Fru family is a large and complex family which includes several sequenced fructose and mannitol-specific permeases as well as several putative PTS permeases of unknown specificities.The Fru family PTS systems typically have 3 domains, IIA, IIB and IIC, which may be found as 1 or more proteins. The fructose and mannitol transporters form separate phylogenetic clusters in this family. This family is specific for the IIC domain of the mannitol PTS transporters. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129930
View PSSM: TIGR00851
Aligned: 4 rows
Threshold Bit Score: 557.896
Threshold Setting Gi: 1709899
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P50852        14 KIQRFGSYLSGMIMPNIGAFIAWGIITALFIPTGWLPNETFAKLVGPMITYLLPLLIGYTGGKMIYDVRGGVVGATATMG 93  Geobacillus ste...
BAA07350      14 KVQRFGSYLSGMIMPNIGAFIAWGIITALFIPAGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIG 93  Bacillus subtilis
P00550         8 KVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLLPLLIGYTGGKLVGGERGGVVGAITTMG 87  Escherichia col...
WP_015900904  13 KVQAFGSFLSSMIMPNIGAFIAWGFIAAIFIDNGWFPNKDLAQLAGPMITYLIPLLIAFSGGRLIHDLRGGIIAATATMG 92  Staphylococcus ...
P50852        94 VIVG-SDIPMFLGAMIMGPLGGYLIKKFDQQIQGKVKQGFEMLVNNFSAGIIGGLLTLAAFKGVGPVVSAISKTLAAGVE 172 Geobacillus ste...
BAA07350      94 VIVG-SDIPMFLGAMIMGPLGGYLIKQTDKLFKDKVKQGFGIRINNFTAGIVGAALTILAFYAIGPVVLTLNKLLAAGVE 172 Bacillus subtilis
P00550        88 VIVG-ADMPMFLGSMIAGPLGGWCIKHFDRWVDGKIKSGFEMLVNNFSAGIIGMILAILAFLGIGPIVEALSKMLAAGVN 166 Escherichia col...
WP_015900904  93 VIVAlPDTPMLLGAMIMGPLVGWLMKKTDEFVQPRTPQGFEMLFNNFSAGILGFIMTIFGFEVLAPIMKFIMHILSVGVE 172 Staphylococcus ...
P50852       173 KIVDLHLLPLANIFIEPGKVLFLNNAINHGILSPLGIEQAAKTGKSILFLLEPNPGPGLGILLAYWLFGKGMAKQSAPGA 252 Geobacillus ste...
BAA07350     173 VIVHANLLPVASVFLEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFLVEANPGPGLGIFLAYMFFGKGSSKSTAPGA 252 Bacillus subtilis
P00550       167 FMVVHDMLPLASIFVEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAKQSAGGA 246 Escherichia col...
WP_015900904 173 ALVHAHLLPLVSILVEPAKIVFLNNAINHGVFTPLGADQAAHAGQSILYTIESNPGPGIGVLIAYMIFGKGTAKATSYGA 252 Staphylococcus ...
P50852       253 IIIHFLGGIHEIYFPYVLMRPILILAAIAGGVSGVLTFTIFDAGLVAVPSPGSIFALLAMTPKGNYLGVLAGVLVATAVS 332 Geobacillus ste...
BAA07350     253 AIIHFFGGIHEIYFPYILMKPGPDSRSHCRRSKRTLNITIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVS 332 Bacillus subtilis
P00550       247 AIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSILAVLAMTPKGAYFANIAGVCAAMAVS 326 Escherichia col...
WP_015900904 253 GIIQFFGGIHEIYFPYVLMRPLLFVSVILGGMTGVATYSLLDFGFKTPASPGSIIVYAINAPKGEFLHMLTGVVLAALVS 332 Staphylococcus ...
P50852       333 FFVASIFLKSAKNNEED-I 350 Geobacillus stearothermophilus
BAA07350     333 FIVSAVILKSSKASEED-L 350 Bacillus subtilis
P00550       327 FVVSAILLKTSKVKEEDdI 345 Escherichia coli K-12
WP_015900904 333 FVVSALILKFTKDPKQDlA 351 Staphylococcus carnosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap