Conserved Protein Domain Family
gutA

?
TIGR00849: gutA 
PTS system, glucitol/sorbitol-specific IIA component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria.The system in E.Coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129929
View PSSM: TIGR00849
Aligned: 3 rows
Threshold Bit Score: 199.715
Threshold Setting Gi: 2342568
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P05706     1 MTVIYQTTITR---IGASAIDALSdqMLITFREGAPADLEEYCFIHCHGELKG-ALHPGLQFSLGQHRYPVTAVGSVAED 76  Escherichia coli K-12
CAA74943   1 MTIVYESTFVAgryIGLRIIGQMT--FSITFGEGAPEDIAEYCFIHRNDINQGgLLGAGSMLTIGEQHYPVTAVGEVARE 78  Erwinia amylovora
CAA05515   3 SKIIYENKVKD---LGDLAETFLEegMIIFFGDNAPDTLADYCYSINIKEVKE-TIKPGQVFMIDGIAFEITAVGDVAEK 78  Clostridium beijeri...
P05706    77 NLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGsvLKFESVKE 123 Escherichia coli K-12
CAA74943  79 NLRDLGHITVRFDGANHAEFPGSVHVTGQPPLVIEPG--QKFRVVSE 123 Erwinia amylovora
CAA05515  79 NLVSLGHITVAFNGSKVPTLSGTICVEKKEIPKLKIG--SELSILA- 122 Clostridium beijerinckii NCIMB 8052
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap