Conserved Protein Domain Family
ccoS

?
TIGR00847: ccoS 
cytochrome oxidase maturation protein, cbb3-type
CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus. [Energy metabolism, Electron transport, Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129927
View PSSM: TIGR00847
Aligned: 7 rows
Threshold Bit Score: 73.9969
Threshold Setting Gi: 120210
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P18399        1 MNTLIYLIPVALSLGGLGLVAFLWALKSGQYEDLDGASWRILddGDGEGESSQ 53  Sinorhizobium meliloti 1021
AAC46115      1 MSVLTYLIPISLFLGGFGLVAFLWSLRARQYDDPKGDAERILs-GKYDDRPKS 52  Rhodobacter capsulatus
CAA04808      1 MNMLIYLIPIALLMGGIGLLAFLWSLKSGQYDDLQGAAWRIL----AEDETDQ 49  Rhizobium leguminosarum
AAF44625      1 MDILAYLIPISLFLGGLGLAAFFWSLRSRQYDDPEGDANRILk-TDYDEHPRQ 52  Rhodobacter sphaeroides
BAC48035      1 MEILVILVPLALMLGGAGLVAFLWSLRSGQYDDLDGAAWRAI----ADDEPPQ 49  Bradyrhizobium diazoefficiens USDA 110
WP_001090950  3 TEILTIMLVVSVLMGLVGLIAFLWGVKSGQFDDEKRMLESVL--YDSASDLNE 53  Helicobacter pylori
WP_003674787  1 MESMFILVPISIILAFVIGWFFWWSGKNGQFDDLEGPAHRIL----MDDDSTS 49  Neisseria cinerea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap