Conserved Protein Domain Family
benE

?
TIGR00843: benE 
benzoate transporter
The benzoate transporter family contains only a single characterised member, the benzoate transporter of Acinetobacter calcoaceticus, which functions as a benzoate/proton symporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129923
View PSSM: TIGR00843
Aligned: 2 rows
Threshold Bit Score: 526.447
Threshold Setting Gi: 543886
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA15061  29 MLRCLYAITHEVTMRlFSippptlLAGFLAVLIGYASSAAIIWQAAIVAGATTAQISGWMTALGLAMGVSTLTLTLWYRV 108 Escherichia coli
P07775     1 MTTLLKTLKQDWSLS-AT------IAGFLAVLISYSGPLIIFFQAAQKAHVSTEMMISWIWAISIGAAVTGIFLSIRFKT 73  Acinetobacter sp. ADP1
BAA15061 109 PVLTAWSTPGAALLVTGLQGLTLNEAIGVFIVTNALIVLCGITGLFARLMRIIPHSLAAAMLAGILLRFGLQAFASLDGQ 188 Escherichia coli
P07775    74 PVVTAWSAPGTALLVTLFPNISLNEAVAAYITAAIVIFLVGITGYFDKLLKWIPQGIAAGMMAGILFQFGLGLFLATDTL 153 Acinetobacter sp. ADP1
BAA15061 189 FTLCGSMLLVWLATKAVAPRYAVIAAMIIGIVIVIAQGDVVTTDVVFKPVLPTYITPDFSFAHSLSVALPLFLVTMASQN 268 Escherichia coli
P07775   154 PLIVFSMLLCYLISRRFSPRYCMLWVLICGVAFSFFLGKMNPVPLDFQIARPQFIAPEWSWFSTLNLALPLILVSLTGQF 233 Acinetobacter sp. ADP1
BAA15061 269 APGIAAMKAAGYSAPVSPLIVFTGLLALVFSPFGVYSVGIAAITAAICQSPEAHPDKDQRWLAAAVAGIFYLLAGLFGSA 348 Escherichia coli
P07775   234 LPGMAILKLSGYNTPAKPIIAAASLASLFAAFAGGITIVLASITATLCMGKDAHELKDKRYIAGIANGLFYVLGGVFAGS 313 Acinetobacter sp. ADP1
BAA15061 349 ITGMMAALPVSWIQMLAGLALLSTIGGSLYQALHNERERDAAVVAFLVTASGLTLVGIGSAFWGLIAGGVCYVVL 423 Escherichia coli
P07775   314 IVALFSLLPKELVAALAGLALLGAIASNIKIAMQEDQQRDPALITFLATVSGMHFLGLSSVFWGMCIGMLAYFIL 388 Acinetobacter sp. ADP1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap