1TJ7


Conserved Protein Domain Family
argH

?
TIGR00838: argH 
Click on image for an interactive view with Cn3D
argininosuccinate lyase
This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens. [Amino acid biosynthesis, Glutamate family]
Statistics
?
PSSM-Id: 129918
View PSSM: TIGR00838
Aligned: 11 rows
Threshold Bit Score: 640.556
Threshold Setting Gi: 6225066
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TJ7_A   3 LWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEEALNVLLEDVRARp-QqILESDA 81  Escherichia coli BW2952
P11447   3 LWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEEALNVLLEDVRARpqQ-ILESDA 81  Escherichia coli K-12
P44314   3 LWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIQGSIGWSKALVKVNVLTIEEQHQLEQALNELLVEVRSNpqA-ILQDDA 81  Haemophilus influenza...
P73257   5 TWSDRFEGTLHPAIALFNASIGFDIELIEYDLDGSIAHGKMLAKTGIISPGEAEQLVQGLEQIRQEYRAGn-F-NPGVDQ 82  Synechocystis sp. PCC...
O34858   4 LWGGRFQKTPEKWVDEFGASISFDQNLVAEDITGSLAHAAMLKKCGILTAEEELKIREGLNTLLQKAEEGa-L-EFSVDY 81  Bacillus subtilis sub...
O67383   4 PWSGRFKEETDKFVEDFTESVSFDKELAFEDIEQDIAHVKTLQKAGILTEEEARELIQELLKIKEEIKEGk-F-QWKKEL 81  Aquifex aeolicus VF5
P04076   8 LWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTAGLQKLGLLTETELAKIHEGLAEIKKEWDADk-F-VRHPND 85  Saccharomyces cerevis...
P94994   8 LWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLDSLAQDVADGs-F-GPLVTD 85  Mycobacterium tubercu...
Q58201   4 LRRGRLGNSIKEDVAKYTTSLSFDKEIFEADILCDIAHVIMLYEQGIIKKEDAKKIIEGLKEIYKKGMEN--L-NLDPSL 80  Methanocaldococcus ja...
O29379   2 LRESRMKKGMDPKALKLSSSIEHDKNIFLYDILVDVAHVLTLKKGGYLSEEEAKEIILALKKVKDSGFR------EDWPY 75  Archaeoglobus fulgidu...
O26369   3 LRAGRLNSGMEDEAAEFTSSLTFDHHIFEADIECNMAHTRMLAHEGIIPEEVAAKIIDALESLREEGIEA--L-DMDPSV 79  Methanothermobacter t...
1TJ7_A  82 EDIHSWVEGKLIDKVG-QLGkKLHTGRSRNDQVATDLKLWCKDTVSE-LLTANRQLQSALVETAQNNQDAVMPGYTHLQR 159 Escherichia coli BW2952
P11447  82 EDIHSWVEGKLIDKVG-QLGkKLHTGRSRNDQVATDLKLWCKDTVSE-LLTANRQLQSALVETAQNNQDAVMPGYTHLQR 159 Escherichia coli K-12
P44314  82 EDIHSWVESKLIDKVG-NLGkKLHTGRSRNDQVAVDIKLWCKQRVIE-LQESVRNLQRHLVQTAENTQQAVMPGYTHLQR 159 Haemophilus influenza...
P73257  83 EDVHFAVERRLTELVG-DVGkKLHTARSRNDQVGTDVRLYLRAQIDD-IRQRLRDFQAVLLQLAETNVETLIPGYTHLQR 160 Synechocystis sp. PCC...
O34858  82 EDIHLNIEKMLIDEIG-PLGgKLHTGRSRNDQVATDMHLYLKNHVGH-IIELIEAFQSALIEKAEANVETILPGYTHLQR 159 Bacillus subtilis sub...
O67383  82 EDVHMNIEAELINRLG-DVGrKLHTARSRNDQVATDEKLYLKKEIKE-VLQLLKELRKTLVELAETTVDFVMPSYTHLQR 159 Aquifex aeolicus VF5
P04076  86 EDIHTANERRLGELIGrDIAgKVHTGRSRNDQVVTDLRIYCRDIVNDtLFPALKGLVEVLIKRAEGEIDVLMPGYTHLQR 165 Saccharomyces cerevis...
P94994  86 EDVHAALERGLIDRVGpDLGgRLRAGRSRNDQVAALFRMWLRDAVRR-VATGVLDVVGALAEQAAAHPSAIMPGKTHLQS 164 Mycobacterium tubercu...
Q58201  81 DDIHMVIESELIKKLGeDVAgRMHTGRSRNDEVATDLRIALREKVLI-IAKSLIKMLKDILELAEKHKETLIVGYTHLQH 159 Methanocaldococcus ja...
O29379  76 EDVHEAIEAEVTKITPhGAK--MHTGRSRNDEVATCLRMFARDHLLN-LAEAILNALDVLIKKAEKS-HFLMPGFTHLQY 151 Archaeoglobus fulgidu...
O26369  80 EDIHMAVENYVTARIGeEAG-FMHTGKSRNDQVATDLRLALRERIRT-ISRELLDFIDSISDLALDHTETVMVGYTHLQH 157 Methanothermobacter t...
1TJ7_A 160 AQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELL 239 Escherichia coli BW2952
P11447 160 AQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELL 239 Escherichia coli K-12
P44314 160 AQPITFAHWCMAYVEMFDRDYSRLTDAYNRMNTCPLGSGALAGTAYAVDRDSLAHDLSFAFATRNSLDSVSDRDHIVELL 239 Haemophilus influenza...
P73257 161 AQPVSLAHHLLAYFQMAQRDWQRLGEIRARTNVSPLGSGALAGTTFPIDRHYSAELLGFAGVYANSLDGVSDRDFAIEFL 240 Synechocystis sp. PCC...
O34858 160 AQPISFAHHLLAYFWMLERDKERFQDSMKRINKSPLGCGALAGTTFPIDRDYSAELLGFDAIYENSLDGVSDRDFILEFL 239 Bacillus subtilis sub...
O67383 160 AQPIRVAHYFLAYREILLKDSERLMDTYRRVDELPLGSGAVAGVDFPLDRFYTAELLGFNRVTRNSMYATAERDFIIEFL 239 Aquifex aeolicus VF5
P04076 166 AQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSPLGAGALAGHPYGIDREFLAEGLGFNSVIGNSLVAVSDRDFIVELM 245 Saccharomyces cerevis...
P94994 165 AQPILLAHHLLAHAHPLLRDLDRIVDFDKRAAVSPYGSGALAGSSLGLDPDAIAADLGFSAAADNSVDATAARDFAAEAA 244 Mycobacterium tubercu...
Q58201 160 AQPVTFAHHLLSYVSAIERDILRLLDAYKRINISPLGCGAMATTGFKINRERTKELLGFDALIENSMDGVSARDFILETM 239 Methanocaldococcus ja...
O29379 152 AQPTRLSHHLLAYHDMLSRDFERAIEAFRRVNKSPLGSAAFASTGYSLDRVYAARLLGFDGVVEHSEDAVASRDFVIESI 231 Archaeoglobus fulgidu...
O26369 158 AQPTTLGHHLMAYASSLRRDYERLQDTLKRVDQNPLGSAAMTTTSFPINRELTTRLLGFSDYMKNSMDAVSARDFIAETV 237 Methanothermobacter t...
1TJ7_A 240 SAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNK 319 Escherichia coli BW2952
P11447 240 SAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNK 319 Escherichia coli K-12
P44314 240 SIASLSMAHLSRFAEDMIIFNSGEANFVELSDRVTSGSSLMPQKKNPDACELIRGKTGRVIGSLTSMLITLKGLPLAYNK 319 Haemophilus influenza...
P73257 241 NAASLIMVHLSRLSEEMILWASQEFSFISLTDSCATGSSIMPQKKNPDVPELIRGKAGRVMGHLQGMLVLMKGLPLAYNK 320 Synechocystis sp. PCC...
O34858 240 SNSSMLMMHLSRFSEEIILWCSQEFKFIELDDTYATGSSMMPQKKNPDMAELIRGKTGRVYGDMMGLFTIMKGLPLAYNK 319 Bacillus subtilis sub...
O67383 240 SNCALIAQHLSRLAEDLIIWNTEEFNFVELPDKLCTGSSIMPQKKNPDVLELIRGKTGRIYGNLIALLTTMKALPMAYNR 319 Aquifex aeolicus VF5
P04076 246 FWGTLFMNHISRFAEDLIIYCTAEFGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLTGFLMSLKGIPSTYDK 325 Saccharomyces cerevis...
P94994 245 FVFAMIAVDLSRLAEDIIVWSSTEFGYVTLHDSWSTGSSIMPQKKNPDIAELARGKSGRLIGNLAGLLATLKAQPLAYNR 324 Mycobacterium tubercu...
Q58201 240 ADLAILGTNLSKICEELILFSTYEFGTIEIANEFCSTSSIMPQKKNPDVAEIARAKLSKLNGNLVTALTILKALPNTYNR 319 Methanocaldococcus ja...
O29379 232 FVAAEAMLSISRIAEEIVLFSS-EFGFITLPDEFSSTSSIMPQKKNPDIAELLRANAGKIAGNLTSAMMIYKATPFSYNR 310 Archaeoglobus fulgidu...
O26369 238 FDLSMLAVNLSRISEEMILWSTHEFGIVEIPDEFSSTSSIMPQKKNPDVAEIARAKTSTVQGELVTILGIMKALPYTYNR 317 Methanothermobacter t...
1TJ7_A 320 DMQEDKEGLFDALDTWLDCLHMAALVLDG-IQVKRPRCQEAAQQGYANATELADYLVAK-GVPFREAHHIVGEAVVEAIR 397 Escherichia coli BW2952
P11447 320 DMQEDKEGLFDALDTWLDCLHMAALVLDG-IQVKRPRCQEAAQQGYANATELADYLVAK-GVPFREAHHIVGEAVVEAIR 397 Escherichia coli K-12
P44314 320 DMQEDKEGIFDALDTWQNCVDMATFVLDE-LKVNVERTREAALKGYSNATELADYLVSK-GVPFRDSHHIVGETVVYAIE 397 Haemophilus influenza...
P73257 321 DLQEDKEALFDAVKTVQVSLEAMTILLDEgIVFRQERLAEAVAEDFSNATDVADYLAAK-GVPFREAYNLVGKVVKTSLA 399 Synechocystis sp. PCC...
O34858 320 DLQEDKEGMFDTVKTVEGSLQIFTGMIQT-MTVNKDVMKQATKQDFSNATELADYLAKK-GMPFREAHEVVGKLVYTCIE 397 Bacillus subtilis sub...
O67383 320 DMQEDKEPLFDTLKNLKNMIKGMTLVLSD-LRVKEQN-MRKASGNFLLITDIANYLVEK-GVPFRTAHHIAGSIVAYLLE 396 Aquifex aeolicus VF5
P04076 326 DMQEDKEPLFDCLTTVEHSMLIATGVIST-LTVNKEK-MEAALTMDMLATDLADYLVRK-GVPFRETHHISGECVATAER 402 Saccharomyces cerevis...
P94994 325 DLQEDKEPVFDSVAQLELLLPAMAGLVAS-LTFNVQRMAELAPAGYTLATDLAEWLVRQ-GVPFRSAHEAAGAAVRAAEQ 402 Mycobacterium tubercu...
Q58201 320 DLQEISPHLWDSVYTTIDTIKMVHGMLKT-IKINKERMEELAKANYSTATELADTLVREtGIPFRTAHGIVGEVVRRSIE 398 Methanocaldococcus ja...
O29379 311 DFQEMNPLLYESLKRTHLAVEVFASMMGK-IKFNPEITERKASKGFATATELADMLVMKyGVPFRMAHRIVGRLAAKELE 389 Archaeoglobus fulgidu...
O26369 318 DLQEVTPHLWRAVDTVLSMIRVVRGMLLG-IRVNRNRALELAGANFATATDLADIIVRErGIPFRVAHRIVGRLVTRAIE 396 Methanothermobacter t...
1TJ7_A 398 QGK--------PLEDLPLSELQKfSQVIDED-VYPILSLQSCLDKRAAKGGVSP---QQVAQAIAFAQARLG 457 Escherichia coli BW2952
P11447 398 QGK--------PLEDLPLSELQKfSQVIDED-VYPILSLQSCLDKRAAKGGVSP---QQVAQAIAFAQARLG 457 Escherichia coli K-12
P44314 398 KGK--------GLEDLTIPEFRQfSEVVGDD-VYEILSLQSCLDKRCAKGGVSP---LRVAEAIAEAKTRFA 457 Haemophilus influenzae Rd KW20
P73257 400 AGK--------LLKDLTLAEWQAlHPAFEED-IYQAITPQQVVAARNSYGGTGF---EQVKMAIANAKAELS 459 Synechocystis sp. PCC 6803 su...
O34858 398 RGI--------YLSDMPFGEFQQaSTLFEED-IYTVLDPYYAVEKRMSAGGTGF---KQVEQALEKAKACVA 457 Bacillus subtilis subsp. subt...
O67383 397 KGK--------KLEEMTLEEFKQfSEKFEED-VFDILSPERAADRKRVYGGTAK---EEILRIIEVAKAEEG 456 Aquifex aeolicus VF5
P04076 403 LGLs-------GIDKLTLEQYQKiDSRFGQD-LFETFNFEQSVERRDATGGTAK---SAVLKQLDNLKSQLN 463 Saccharomyces cerevisiae S288c
P94994 403 RGV--------GLQELTDDELAAiSPELTPQ-VREVLTIEGSVSARDCRGGTAPgrvAEQLNAIGEAAERLR 465 Mycobacterium tuberculosis
Q58201 399 Ek--------kDMIEVIYEVLEKyNLKVDEEkIKKALDPYENVKMRDVIGGPAP---EEVEKRIKVFRERLD 459 Methanocaldococcus jannaschii...
O29379 390 Rpt------asDVNSAAKELGVE--INVRDEdVLEALDVEKVVENRGNLGGTSK---AEVERMIKARKSDLK 450 Archaeoglobus fulgidus DSM 4304
O26369 397 DGLapgdvdsvYLDEVSLEVTGR-KLELDPElVEKALDPLENVRMRRIPGGPAP---EMVRVAVEEMKSFIE 464 Methanothermobacter thermauto...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap