Conserved Protein Domain Family

TIGR00833: actII 
Transport protein
The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family (TC 2.A.6.5)Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. This sub-family includes the S. coelicolor ActII3 protein, which may play a role in drug resistance, and the M. tuberculosis MmpL7 protein, which catalyzes export of an outer membrane lipid, phthiocerol dimycocerosate. [Transport and binding proteins, Unknown substrate]
PSSM-Id: 129913
Aligned: 5 rows
Threshold Bit Score: 528.772
Threshold Setting Gi: 6225694
Created: 7-Oct-2014
Updated: 2-Oct-2020
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q53902    457 G------------------------------------L------AYVEATLG---------------------------- 466  Streptomyces coel...
CAB50583  494 DVVIQK-Y-----G---------------------YIPQDKEKISEAIEGSS---------------------------- 518  Pyrococcus abyssi...
Q53902        --------------------------------------------------------------------------------      Streptomyces coel...
CAB50583  519 ------------------------------------------------------------------------------LV 520  Pyrococcus abyssi...
Q53902    467 --A--------------------------------------------------------------------------GAD 470  Streptomyces coel...
CAB50583  521 S-----------------------------------------------------------------SDYSMTIIKLKGNF 535  Pyrococcus abyssi...
Q53902    471 SPAA---------------------------------------------------------------MRSVTAARETLAR 487  Streptomyces coel...
CAB50583  536 MGVT-------------------------------------------------------QS--EFNRIMEYFERAIQRAD 558  Pyrococcus abyssi...
CAB01394  956 FTIGIGIVLDTFLVRTVTVPALTTMIGRANWWP 988  Mycobacterium tuberculosis H37Rv
P54881    900 TTIGLGLLFDTLIVRSFMMPSIAALLGRWFWWP 932  Mycobacterium leprae TN
Q53902    647 FTVAVGVLLDTMIVRSVLVTALTLDVGRWMWWP 679  Streptomyces coelicolor A3(2)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap