Conserved Protein Domain Family
actII

?
TIGR00833: actII 
Transport protein
The Resistance-Nodulation-Cell Division (RND) Superfamily- MmpL sub family (TC 2.A.6.5)Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. This sub-family includes the S. coelicolor ActII3 protein, which may play a role in drug resistance, and the M. tuberculosis MmpL7 protein, which catalyzes export of an outer membrane lipid, phthiocerol dimycocerosate. [Transport and binding proteins, Unknown substrate]
Statistics
?
PSSM-Id: 129913
View PSSM: TIGR00833
Aligned: 5 rows
Threshold Bit Score: 528.772
Threshold Setting Gi: 6225694
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB01394   22 RWPLIVIGCWIAVAAALTLLLPTLQAQAAKREQAPLPPGAPSMVLQKEMSAAFQEKIETSALLLVLLTNEnGLGPADEAV 101  Mycobacterium tub...
CAB44659   10 RYAIWIVGVWALAAIIGNNFAPPLEQVITAEDQPFSPAGTATSRAVERSAAAFSQAPGDNIGYLVLERNG-VLNDQDRAY 88   Mycobacterium bov...
P54881     24 RFAVPIILVWLAIAVTVSVFIPSLEDVGQERSVSLSPKDAPSYIAMQKMGQVFNEGNSDSVIMIVLEGDK-PLGDDAHRF 102  Mycobacterium lep...
Q53902     13 RLKWLVLAAWIGLLIVLQPLAGKLGDVESNDAAAWLP-GNAESTEVLELSEKFQPADTSPTVIVYDRPSG---------I 82   Streptomyces coel...
CAB50583   26 LSAYGITQLRFETDLSKQLPEDLEAVKSYFTLQNEFGGSGSALIYVKIKNNDNVVDIRDPKIIEAMYSLEqRLREKEYVT 105  Pyrococcus abyssi...
CAB01394  102 YRKLIENLRADT-------QDKISVQDFLAVPEMKELLASKDNKAWNLPITFAGDAASPETQAAFKRVAAIVKQTVAGTS 174  Mycobacterium tub...
CAB44659   89 YDALVVALRRDS-------RHVIEVVDWWGTPAIAEVARSDDHHAVTAALRFGGMVGTSQAGESITAARSIVTQLHPPDG 161  Mycobacterium bov...
P54881    103 YDGLIRKLRAD--------KHVQSVQDFWGDPLTAPGAQSNDGKAAYVQLSLAGNQGELLAQESIDAVRKIVVQTPAPPG 174  Mycobacterium lep...
Q53902     83 TAADEAKARADA-------THFADGTGVVGEPYGP--VRSDDGKALRTVVNVHLGKDGWEGLNAAAKDMRAIARPSAPDG 153  Streptomyces coel...
CAB50583  106 DTFSIADLMVQIlgrlpknMDEVKFVLNMLPPEARNGLISGDYSSTIIIVNLNREKNQKALVRVYNDIEREIERTNFPQG 185  Pyrococcus abyssi...
CAB01394  175 LTVHLSGPIATVADLTELGEKDVRIIEIGTAVSVLIILILVYRNLVTMLVPLATIGASVVTAQGTLSGLAEFGLA-VNMQ 253  Mycobacterium tub...
CAB44659  162 LHVFVTGPGATIVDEFAAIDRQTQLITATTIVVLLILLLIVYRSAITATVPLLSVVVSLAVAKPIVSVLVDRDFIgISLF 241  Mycobacterium bov...
P54881    175 ITAWVTGASALIADMHHSGDKSMIRITATSVIVILVTLLLVYRSFITVILLLFTVGIESAVARGVVALLGHTGLIgLSTF 254  Mycobacterium lep...
Q53902    154 LGVHVTGPTGYAADSAESFSSADFKLTLVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLLAKNAGLtVNAQ 233  Streptomyces coel...
CAB50583  186 VEVVLTGDLGITYKILEMLQNDMNRTMAISGIIVVLILLYFYKSPIRMLVPLVPLIFGVVMTLGFMGLLGIPLDI---AT 262  Pyrococcus abyssi...
CAB01394  254 AIVFMSAVMIGAGTDYAVFLISRYHDYVRHGEKSDMAVKKALMSIGKVITASAATVA---VTFLAMVFTKLEVFSAVGPA 330  Mycobacterium tub...
CAB44659  242 SLGLSVAVVVGAGTGFAMFLIGRYHERRRQHIAPAAALADAYRGVAPAIAGATFIVVtslGAVGWLSLARIGMFATTGIL 321  Mycobacterium bov...
P54881    255 AVNLLTSLAIAAGTDYGIFITGRYQEARQANENKEAAFYTMYRGTFHVILGSGLTIS---GATFCLSFARMPYFQTLGVP 331  Mycobacterium lep...
Q53902    234 TAMILTVLVLGAATDYALLLVARYREELRRHEDRHEAMAVALRRAGPAIVASAATVA---VSMLVLLLAALNSTKGLGPV 310  Streptomyces coel...
CAB50583  263 TTVG--AMIIGMGIDYGVHVTNRYYEERGKGKSLEEAAEEAIAETGKALLGAALTTI---AGFLALSISILPSLKRLSVS 337  Pyrococcus abyssi...
CAB01394  331 IAVAITVSLLGAVTLLPAILTLTG--RRGWIKP-------RRDLTSR-MWRRSGVRIVRRSTIHLVGS-LIVLVALAGCT 399  Mycobacterium tub...
CAB44659  322 CSIGVLAVGLAALTLTPALVALAS--RANLLKP-------PQHKRIQrQFRRLGTHVARWPAPILVAS-GVFVLIMMIAL 391  Mycobacterium bov...
P54881    332 CAVGMLIAVAVALTLGPAVLTVGS--RFGLFEP-------KRLIKVR-GWRRIGTVVVRWPLPILITT-CAIAMVGLLAL 400  Mycobacterium lep...
Q53902    311 CAVGVLVGLLSMMTLLPALLVIFG--RWVFWPArpk--hgTEPDVTRgLWSRIARLVSGRPRAVWVTTsLLLGAVATLAV 386  Streptomyces coel...
CAB50583  338 LVMGLGLAALNAVIVTPALAILEEefREKVMKKkeiiaigGGKSKISfIFSMLGKAIKRSPWTALLIA-LIISGVSLYGA 416  Pyrococcus abyssi...
CAB01394  400 LLIRFNYDDLKTVPQHVESVKGYEAMNRHFPMNAMTPMVLFIKSPRDLRTPGALADIEMMSREIAELPNIVMVRGLTRPN 479  Mycobacterium tub...
CAB44659  392 PRVPIGWDEAAATPSAAESNRGYRAADRHFAPNQLLPTQVMIETDHDIRNPAGLTAIERITAAIMAIGGVRMVQSASHPN 471  Mycobacterium bov...
P54881    401 PGYRTNYKDRAYLPASIPANQGFAAADRHFPQARMKPEILMIESDHDMRNPADFLILDKLARGIFRVPGISRVQAITRPD 480  Mycobacterium lep...
Q53902    387 TLNADGLQQKDGFKTKPESVVGEEILTRHFPAGSGEPMVVIAKG----------ASADQVHAALETVPGVIEVAPPQVKD 456  Streptomyces coel...
CAB50583  417 SKITTEVRLEKMIPTDLPEIQALSDIRSEFGGQ--DEVTILIKAD-DVRDPTLVRDILRFEREIKADSYINNVFETQSIA 493  Pyrococcus abyssi...
CAB01394  480 GEPLKETKVSFQAGEVGGKLDEATTLLEEHggeLDQLTGGAHQLADALAQIRneingavasssgivnTLQAMMDLMGgdk 559  Mycobacterium tub...
CAB44659  472 GMVSKQAALTASAGNLGDQLDEFSDQLTSR---QATFTNLEAAVRDVVSALD---------------LVQAGIRQDG--- 530  Mycobacterium bov...
P54881    481 GTAMDHTSIPFQISMQNAGQVQTMKYQKDR---MNDLLRQAENMAETIASMR---------------RMHQLMALLT--- 539  Mycobacterium lep...
Q53902    457 G------------------------------------L------AYVEATLG---------------------------- 466  Streptomyces coel...
CAB50583  494 DVVIQK-Y-----G---------------------YIPQDKEKISEAIEGSS---------------------------- 518  Pyrococcus abyssi...
CAB01394  560 tirqlENASQYVGRMRALGDNLSGTVTDAEQIATWASPMVNALNSSPVCNSDPACRTSRaqlaAIVQAQDDgllrsirAL 639  Mycobacterium tub...
CAB44659  531 -----YGLGQVSLAVRLMQQAITKLQGSAGDVFDIFDPLRRFVAAIPECRANPVCSVAQ----EVVQWANT-------VT 594  Mycobacterium bov...
P54881    540 -----ENTHHILNDTVEMQKTTSKLRDEIANFDDFWRPIRSYFYWERHCFNIPICWSFR----SIFDALDG-------VD 603  Mycobacterium lep...
Q53902        --------------------------------------------------------------------------------      Streptomyces coel...
CAB50583  519 ------------------------------------------------------------------------------LV 520  Pyrococcus abyssi...
CAB01394  640 AVTLQQTQEYQTLARTVSTLDGQLKQVVSTLKAVDGLPTKLAQMQQGANALADGSAalaa-gvqELVDQVKKMGSGLNEA 718  Mycobacterium tub...
CAB44659  595 ESCAKLADAAGQLARGIADVASATSGVSGLPNALDGIGGQLAQVRESAAGVQELLNnvgaaplrELPDYLRELAAVSQSA 674  Mycobacterium bov...
P54881    604 QIDERLNSIVGDIKNMDLLMPQMLEQFPPMIESMESMRTIMLTMHSTMSGIFDQMN--------ELSDNANTMGKAFDTA 675  Mycobacterium lep...
Q53902    467 --A--------------------------------------------------------------------------GAD 470  Streptomyces coel...
CAB50583  521 S-----------------------------------------------------------------SDYSMTIIKLKGNF 535  Pyrococcus abyssi...
CAB01394  719 ADFLlgikrdadkpsmagFNIPPQIFSRDEFKKGAQIFLSADGHAARYFVQSALNPATTEAMDQVNDILRVADSARPNTE 798  Mycobacterium tub...
CAB44659  675 PGVD--------------LYAARRILTDPNMRAVLDYFVSPNGHATRLLVYGDGSEWGDDGAQRARAIVTAVAEETDEGT 740  Mycobacterium bov...
P54881    676 KNDDs-------------FYLPPEVFKNTDFKRAMKSFLSSDGHAARFIILHRGDPASVAGIASINAIRTAAEEALKGTP 742  Mycobacterium lep...
Q53902    471 SPAA---------------------------------------------------------------MRSVTAARETLAR 487  Streptomyces coel...
CAB50583  536 MGVT-------------------------------------------------------QS--EFNRIMEYFERAIQRAD 558  Pyrococcus abyssi...
CAB01394  799 LED-ATIGLAGVPTALRDIRDYYNSDMKFIVIATIVIVFLILVILLRALVAPIYLIGSVLISYLSALGIGTLVFQLILG- 876  Mycobacterium tub...
CAB44659  741 LRP-TAVELTGVGPATRDLQDLVGSDLTLLAVITLAVIFAIAALLLRSPLAGLVVVGTIATSYICALGASVVIWKHILG- 818  Mycobacterium bov...
P54881    743 LED-TKIYLAGTAAVFKDIDEGANWDLVIAGISSLCLIFIIMLIITRAFVAAAVIVGTVALSLGASFGLSVLLWQHILG- 820  Mycobacterium lep...
Q53902    488 LDG-AQARVGGSSAVVHDMREASSRDRGLIIPVILAVVFCILALLLRALVAPLLLIASVVLSFFTALGLAALFFNHVFDf 566  Streptomyces coel...
CAB50583  559 FPPgVKVELAGESYLNYVLNDLVNEELGKISTIGTLIVVMVVFAIFRRPTVSIAMIMPMFLGALWTIGYMGLAGIPFSQ- 637  Pyrococcus abyssi...
CAB01394  877 QEMHWSLPGLSFILLVAIGADYNMLLISRIRDES-PHGIRIGVIRTVGSTGGVITSAGLIFAASMFGLVGASINTMAQAG 955  Mycobacterium tub...
CAB44659  819 DNLHWSVLPIAFVLLISVGSAYNLLFALRIREES-PAGPRTSVIRAFAATGMVVTAAGIVFGTTMFALAASTSLSVAQIG 897  Mycobacterium bov...
P54881    821 IELHYLVLAMSVIVLLAVGSDYNLLLVSRFKQEI-QAGLKTGIIRSMGGTGKVVTNAGLVFAFTMASMVVSDLRVIGQVG 899  Mycobacterium lep...
Q53902    567 AGADSAFPLWVFVFLVALGVDYNIFLVTRIKEESdRLGTRQGALKGLTSTGGVITAAGLVLAGTFAALATLPLVFIAELG 646  Streptomyces coel...
CAB50583  638 ------TLAGVVSMIVGLGVDYGMHITHRFLEEL-NEGNKTPIITALESVGPGIFVGALTTAGGFLALLSAQLTAIHDFG 710  Pyrococcus abyssi...
CAB01394  956 FTIGIGIVLDTFLVRTVTVPALTTMIGRANWWP 988  Mycobacterium tuberculosis H37Rv
CAB44659  898 VTVGMGLLLDALVIRGFVLPALMVLLGRWLWWP 930  Mycobacterium bovis BCG
P54881    900 TTIGLGLLFDTLIVRSFMMPSIAALLGRWFWWP 932  Mycobacterium leprae TN
Q53902    647 FTVAVGVLLDTMIVRSVLVTALTLDVGRWMWWP 679  Streptomyces coelicolor A3(2)
CAB50583  711 RVLAVGIFASMFAAYLVTPAILQLEFGRKISKE 743  Pyrococcus abyssi GE5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap