Conserved Protein Domain Family
a_cpa1

?
TIGR00831: a_cpa1 
Na+/H+ antiporter, bacterial form
The Monovalent Cation:Proton Antiporter-1 (CPA1) Family (TC 2.A.36) The CPA1 family is a large family of proteins derived from Gram-positive and Gram-negative bacteria, blue green bacteria, yeast, plants and animals. Transporters from eukaryotes have been functionally characterized, and all of these catalyze Na+:H+ exchange. Their primary physiological functions may be in (1) cytoplasmic pH regulation, extruding the H+ generated during metabolism, and (2) salt tolerance (in plants), due to Na+ uptake into vacuoles. This model is specific for the bacterial members of this family. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129911
View PSSM: TIGR00831
Aligned: 3 rows
Threshold Bit Score: 573.37
Threshold Setting Gi: 2649761
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P32703     7 ILIMTLVVSLSGVVTRVMPFQIPLPLMQIAIGALLAWPTFGLHVEFDPELFLVLFIPPLLFADGWKTPTREFLEHGREIF 86  Escherichia coli K-12
Q50678    17 VVIVALVAAVVVGTVLGHRYRVGPPVLLILSGSLLGLIPRFGDVQIDGEVVLLLFLPAILYWESMNTSFREIRWNLRVIV 96  Mycobacterium tuber...
AAB90396   7 VEFIEILMLATAVAVTVKFIRLPYTIALVLAGLFVGLAGLLPEVPLSREIVFFIFLPPLLFEAAMNMDLKELRENFGPIA 86  Archaeoglobus fulgi...
P32703    87 GLALALVVVTVVGIGFLIYwvVPGIPLIPAFALAAVLSPTDAVALSGIVGegRIPKKIMGILQGEALMNDASGLVSLKFA 166 Escherichia coli K-12
Q50678    97 MFSIGLVIATAVAVSWTAR--ALGMESHAAAVLGAVLSPTDAAAVAGLAK--RLPRRALTVLRGESLINDGTALVLFAVT 172 Mycobacterium tuber...
AAB90396  87 LIAFLGVVVTTTVVGFSLNw-ILGIPLALALIFGAMVSATDPVSVLATFKsiSAPKKLSILIEGESVLNDGAAIVVFAIA 165 Archaeoglobus fulgi...
P32703   167 VAVAMGTMIFTVGGATVEFMKVAIGGILAGFVVSWLYGrslrfLSRWGGDEPATQIVLLFLLPFASYLIAEHIGVSGILA 246 Escherichia coli K-12
Q50678   173 VAVAEGAAGIGPAALVGRFVVSYLGGIMAGLLVGGLVT-----LLRRRIDAPLEEGALSLLTPFAAFLLAQSLKCSGVVA 247 Mycobacterium tuber...
AAB90396 166 LEMML-KGVFDPLNAALDFAVVCVGGAAVGLAVGYLAYr----IL-AKIDDALVEIAVTIVAAYLGFVLAERFHFSGVIA 239 Archaeoglobus fulgi...
P32703   247 AVAAGMTITRSGVMrRAPLAMRLRANSTWAMLEFVFNGMVFLLLGLQLPGILETSLMAAEIDPNVEIWMLFTNIILIYAA 326 Escherichia coli K-12
Q50678   248 VLVSALVLTYVGPT-VIRARSRLQAHAFWDIATFLINGSLWVFVGVQIPGAIDHIAGEDGGLPRATVLALAVTGVVIATR 326 Mycobacterium tuber...
AAB90396 240 VVAAGLILGNYGRDfSMSPTTRVIMLDFWSVIVFLVNSIIFILIGVNTHITIFSAWKEILVAIAAVILAR---AFVVYPV 316 Archaeoglobus fulgi...
P32703   327 LMLVRFgwLWTMKKFSNRFLKKKPMEFGswtTREILIASFAGVRGAITLAGVLSIPLLLPDGNVFPARYELVFLAAGVIL 406 Escherichia coli K-12
Q50678   327 IAWVQA--TTVLGHTVDRVLKKPTRHVG---FRQRCVTSWAGFRGAVSLAAALAVPMTTNSGAPFPDRNLIIFVVSVVIL 401 Mycobacterium tuber...
AAB90396 317 MTYYRF-------P--N---------------LWKHVVFWGGLRGVIPVALALSFGNQLLSAMAFG-----------VVL 361 Archaeoglobus fulgi...
P32703   407 FSLFVGVVMLPILLQHIEVADHSQQLKEERIARAATAEVAIVAIQKMEERLAadTEENIDNQLLTEVSSRVIGnlrRRAD 486 Escherichia coli K-12
Q50678   402 VTVLVQGTSLPTVVRWARMPEDVAHANELQLARTRSAQAALDALPTVADELG--VAPDLVKHLEKEYEERAVL---VMAD 476 Mycobacterium tuber...
AAB90396 362 FSLLLQGISLEIFVKRKFVSE-SERELEEIIARYIAARSAKFELMKAVEQGR--IVEPVAREMLPNLDAEIEE---LRSK 435 Archaeoglobus fulgi...
P32703   487 GRNDVESSVQEEN-LERRFRLAALRSERAELYHLRATREISNETLQKLLHDLDLLEALLIE 546 Escherichia coli K-12
Q50678   477 GADSATSDLAERNdLVRRVRLGVLQHQRQAVTTLRNQNLIDDIVLRELQAAMDLEEVQLLD 537 Mycobacterium tuberculosis
AAB90396 436 LEEKIRGGMGSKL--RKAAVKYVIDAKKSAVVDAMAGGLVSQEVALEIMRELDSKTAELME 494 Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap