Conserved Protein Domain Family
FRU

?
TIGR00829: FRU 
PTS system, fructose-specific, IIB component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Fru family is a large and complex family which includes several sequenced fructose and mannitol-specific permeases as well as several PTS components of unknown specificities. The fructose components of this family phosphorylate fructose on the 1-position. The Fru family PTS systems typically have 3 domains, IIA, IIB and IIC, which may be found as 1 or more proteins. The fructose and mannitol transporters form separate phylogenetic clusters in this family. This family is specific for the IIB domain of the fructose PTS transporters. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129909
View PSSM: TIGR00829
Aligned: 8 rows
Threshold Bit Score: 130.287
Threshold Setting Gi: 418518
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P32673     5 IAVTACPSGVAHTYMAAEALESAAKAKGWEVKVETQGSIGLENELTAEDVASADMVILTKDIGIKFEErFAGKTIVRVNI 84  Escherichia coli
P23387   120 VAITSCPTGIAHTFMAADALKKTAAARGWEIAVETQGSVGSQNALSAAQIQAADLVVIAADTHVDDSR-FAGKKVYKTSV 198 Rhodobacter capsulatus
AAA27602 121 VAITSCPTGIAHTFMAAEGLQQAAKKLGYHMRVETQGSVGAQDALTDEEIRAADVVIIAADREVDLAR-FGGKRLFKSGT 199 Xanthomonas campestris
P20966   107 VAVTACPTGVAHTFMAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAAADLVIVAADIEVDLAK-FAGKPMYRTST 185 Escherichia coli K-12
P44714   107 VAVTACPTGVAHTFMSAEAIEAYAKKQGWNVKVETRGQVGAGNEITVEEVAAADLVFVAADIDVPLDK-FKGKPMYRTST 185 Haemophilus influen...
P47308   169 VAVTACPTGIAHTFMAKEALEAFAKKHNLYVKVETQGTDGIQNQLTSDDINNAKGVILACDRLIDFSRfYANKNVIEVST 248 Mycoplasma genitali...
P75039   180 VAVTACPTGIAHTFMAKEALEKFARDHNLKVKVETQGTDGIQNQLTESDLNNTKGIILACDRLIDLTRfYGHANVVEVST 259 Mycoplasma pneumoni...
AAF08320 165 IGITACPTGIAHTYMAKEKMEEAAKAMDLTIKVETQGRSGNENVLTATDIANAKGIILGIDKKITGMDrFKDVSYLETST 244 Spiroplasma citri
P32673    85 SDAVK 89  Escherichia coli
P23387   199 GAAVK 203 Rhodobacter capsulatus
AAA27602 200 KPAIN 204 Xanthomonas campestris
P20966   186 GLALK 190 Escherichia coli K-12
P44714   186 GLALK 190 Haemophilus influenzae Rd KW20
P47308   249 TKAIK 253 Mycoplasma genitalium G37
P75039   260 TKAIK 264 Mycoplasma pneumoniae M129
AAF08320 245 KDVIy 249 Spiroplasma citri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap