Conserved Protein Domain Family
EIID-AGA

?
TIGR00828: EIID-AGA 
PTS system, mannose/fructose/sorbose family, IID component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man family is unique in several respects among PTS permease families.It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the IID subunits of this family of PTS transporters. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129908
View PSSM: TIGR00828
Aligned: 4 rows
Threshold Bit Score: 388.012
Threshold Setting Gi: 1172735
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08188  14 KKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPeNNEARKQAIRRHLEFFNTQPFVAAPILGVTLALE 93  Escherichia coli
P37083   4 KKITQGDLVSMFLRSNLQQASFNFERIHGLGFCYDMIPAIKRLYP-LKADQVAALKRHLVFFNTTPAVCGPVIAVTAAME 82  Klebsiella pneumoniae
P26382   5 KRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYG-PGAKRNEALQRHLEWFNTHPWLTAPIFGVTAAME 83  Bacillus subtilis sub...
P42911   3 SEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKdDKPGLSAAMKDNLEFINTHPNLVGFLMGLLISME 82  Escherichia coli K-12
P08188  94 EQRANGAEIDDGAINGIKVGLMGPLAGVGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGY 173 Escherichia coli
P37083  83 EARANGAAIDDGAINGIKVGLMGPLAGVGDPLVWGTLRPITAALGASLALSGNILGPLLFFFIFNAVRLAMKWYGLQLGF 162 Klebsiella pneumoniae
P26382  84 EEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTIRPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGY 163 Bacillus subtilis sub...
P42911  83 EKGENR----D-TIKGLKVALFGPIAGIGDAIFWFTLLPIMAGICSSFASQGNLLGPILFFAVY-LLIFFLRVGWTHVGY 156 Escherichia coli K-12
P08188 174 SKGIDIVKDMGGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQLMPGLVPLLLTFA 253 Escherichia coli
P37083 163 RKGVNIVSDMGGNLLQKLTEGASILGLFVMGVLVTKWTTINVPLVVSQTPGADGATVTMTVQNILDQLCPGLLALGLTLL 242 Klebsiella pneumoniae
P26382 164 VKGMEILQDLAGNRIQKLTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGLTLL 243 Bacillus subtilis sub...
P42911 157 SVGVKAIDKVR-ENSQMIARSATILGITVIGGLIASYVHINVVTSFAIDNTHS----VALQQDFFDKVFPNILPMAYTLL 231 Escherichia coli K-12
P08188 254 CMWLLR-KKVNPLWIIVGFFVIGIAGYACGLL 284 Escherichia coli
P37083 243 MVRLLN-KKVNPVWLIFALFGLGIIGNALGFL 273 Klebsiella pneumoniae
P26382 244 VAWMLR-KGVNPLLIICGIFVIGILGYWAGFL 274 Bacillus subtilis subsp. subtilis str. 168
P42911 232 MYYFLRvKKAHPVLLIGVTFVLSIVCSAFGIL 263 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap