Conserved Protein Domain Family
EIIC-GAT

?
TIGR00827: EIIC-GAT 
PTS system, galactitol-specific IIC component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The only characterized member of this family of PTS transporters is the E. coli galactitol transporter. Gat family PTS systems typically have 3 components: IIA, IIB and IIC. This family is specific for the IIC component of the PTS Gat family. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129907
View PSSM: TIGR00827
Aligned: 3 rows
Threshold Bit Score: 567.147
Threshold Setting Gi: 4512376
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA75340  11 FLDLGATVILPVAIFLLGLAFGQKPGKAFRSGLTIGIAFVGIFLVVDLLVLNLGPAAQGMVDRLGVDLNVIDVGWPATSS 90  Bacillus halodurans
P37189     9 ILDLGPTVMLPIVIIIFSKILGMKAGDCFKAGLHIGIGFVGIGLVIGLMLDSIGPAAKAMAENFDLNLHVVDVGWPGSSP 88  Escherichia coli
P39365     5 ILSLGGTVFVPIIMIVIGLIFRIPWLQAIKAGVTVGIGFVGMGLVIVMAIDSLSPPIKVMIERFGLALHVFDVGAGPASG 84  Escherichia coli K-12
BAA75340  91 IAWASVVAAFIIPLGLIVNVIMLVTKTTKTMNVDIWNFWHYTFMAAVVYTVSDSIIQALIAAVMFQIVALKVADWTAPMV 170 Bacillus halodurans
P37189    89 MTWASQIALVAIPIAILVNVAMLLTRMTRVVNVDIWNIWHMTFTGALLHLATGSWMIGMAGVVIHAAFVYKLGDWFARDT 168 Escherichia coli
P39365    85 VGYATAIGAMIIPVIFLLNVAMLVTRLTKTMNVDIYNYWHYAITGTVVQLMTGSLIYGVLGAICHAALSLKMADWTAKRV 164 Escherichia coli K-12
BAA75340 171 SEFYELPGVSIATGSTISYAPGIWLVKG-IQKIPGIKHWNADPDTIQRRFGIFGESIFIGLILGAAIGLLAGYNVGEVIE 249 Bacillus halodurans
P37189   169 RNFFELEGIAIPHGTSAYMGPIAVLVDAiIEKIPGVNRIKFSADDIQRKFGPFGEPVTVGFVMGLIIGILAGYDVKGVLQ 248 Escherichia coli
P39365   165 QNIVGLEGISIPQGYGSSSVPLFVLLDAiYEKIPFMKGRNIDAQEIQKRYGMVGDPVIIGVVLGLIFGLAAGEGFKGCAS 244 Escherichia coli K-12
BAA75340 250 IGMAMAAVMVLMPRMVKILMEGLMPVSESAREWLNKRFGDREIHIGLDAAVLLGHPSVISTALILVPLTVLLAVILPGNA 329 Bacillus halodurans
P37189   249 LAVKTAAVMLLMPRVIKPIMDGLTPIAKQARSRLQAKFGGQEFLIGLDPALLLGHTAVVSASLIFIPLTILIAVCVPGNQ 328 Escherichia coli
P39365   245 LMITVAAIMVLFPRMIRLIVEGLLPISDGARKFFQKYFKGREVYIGLDTAVTLGHPTTIAVGLLLIPIMLILASILPGNK 324 Escherichia coli K-12
BAA75340 330 LLPFGDLATIPFIVAFIVGAARGNIIHSVLAGAIMIALSLYMATDIAPVFTKMAENSNFNMPEGsaLISSIDQGGNLVNW 409 Bacillus halodurans
P37189   329 VLPFGDLATIGFFVAMAVAVHRGNLFRTLISGVIIMSITLWIATQTIGLHTQLAANAGALKAGG--MVASMDQGGSPITW 406 Escherichia coli
P39365   325 VLPLADLPVAPFFICMATVIHRGDLVRTLISGVIVMITVLLIATQFAPYFTEMALKGGFSFAGEsaQISALSVG-NMFGW 403 Escherichia coli K-12
BAA75340 410 IIWKLFA 416 Bacillus halodurans
P37189   407 LLIQVFS 413 Escherichia coli
P39365   404 SISELMS 410 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap