Conserved Protein Domain Family
EIIBC-GUT

?
TIGR00825: EIIBC-GUT 
PTS system, glucitol/sorbitol-specific, IIBC component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Gut family consists only of glucitol-specific permeases, but these occur both in Gram-negative and Gram-positive bacteria.E. coli consists of IIA protein, a IIC protein and a IIBC protein. This family is specific for the IIBC component. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129905
View PSSM: TIGR00825
Aligned: 3 rows
Threshold Bit Score: 536.385
Threshold Setting Gi: 3914489
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O32522   3 NTIEIRKGESGWGGPLSINVTAGK-KIVYITAG-TKPAIVDHLVALTGWEAVDGFKQGEPPAEEIGVAVIDCGGTLRCGL 80  Erwinia amylovora
P56580   2 THIRIEKGTGGWGGPLELKATPGK-KIVYITAG-TRPAIVDKLAQLTGWQAIDGFKEGEPAEAEIGVAVIDCGGTLRCGI 79  Escherichia coli K-12
O32333   5 NAIKIVKGSGGFGGPLTVKPEEGKdTLLYITGGgAEPEIVEKIVNLTGCKAVNGFKTSVP-EEQIFLVIIDCGGTLRCGI 83  Clostridium beijerinc...
O32522  81 YPKRRIPTINIHATGKSGPLAQFITEDIYVSGVRVADIRVANDAEAAPpevavadvavnagKGTGRDYDTSKKITEQS-D 159 Erwinia amylovora
P56580  80 YPKRRIPTINIHSTGKSGPLAQYIVEDIYVSGVKEENITVVGDATPQP-------------SSVGRDYDTSKKITEQS-D 145 Escherichia coli K-12
O32333  84 YPQKRIPTINVMPVGKSGPLAKFITEDIYVSAVGLNQISLA-DSSAEPikstkvpeegkreFKYSADKKVSQSLAENSkS 162 Clostridium beijerinc...
O32522 160 GLLAKVGMGMGSAVAILFQSGRETIDTVLKTILPFMAFVSALIGIIMASGLGDFIAHGLTPLANSPVGLVTLALICSFPL 239 Erwinia amylovora
P56580 146 GLLAKVGMGMGSTVAVLFQSGRDTIDTVLKTILPFMAFVSALIGIIMASGLGDWIAHGLAPLASHPLGLVMLALICSFPL 225 Escherichia coli K-12
O32333 163 SIVQKIGMGAGKVVNTLYQAGRDAVQSMITTILPFMAFVAMLIGIIQGSGFGNWFAKILVPLAGNGIGLMILGFICSIPL 242 Clostridium beijerinc...
O32522 240 LSPFLGPGAVIAQVIGVLVGVQIGQGTIPPHLALPALFAINAQAACDFIPVGLSLANARQETVRVGVPAVLVGRFITGAP 319 Erwinia amylovora
P56580 226 LSPFLGPGAVIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACDFIPVGLSLAEARQDTVRVGVPSVLVSRFLTGAP 305 Escherichia coli K-12
O32333 243 LSALLGPGAVIAQIVGTLIGVEIGKGTIPPSLALPALFAINTQCACDFIPVGLGLAEAEPETVEVGVPSVLYSRFMIGVP 322 Clostridium beijerinc...
O32522 320 TVLLAWAASSFIYH 333 Erwinia amylovora
P56580 306 TVLIAWFVSGFIYQ 319 Escherichia coli K-12
O32333 323 RVAVAWVASIGLYQ 336 Clostridium beijerinckii NCIMB 8052
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap