1PDO


Conserved Protein Domain Family
EIIA-man

?
TIGR00824: EIIA-man 
Click on image for an interactive view with Cn3D
PTS system, mannose/fructose/sorbose family, IIA component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains.The Man family is unique in several respects among PTS permease families It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine, N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the IIA components. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129904
View PSSM: TIGR00824
Aligned: 5 rows
Threshold Bit Score: 174.958
Threshold Setting Gi: 548631
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1PDO_A         1 TIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIV 80  Escherichia coli
AAB04153       1 MSKIIISGHGQYSIGLLNAFHMIFGENNGYCAVPFLKGEGIPQLQAKIATAVDDFKTEEPILIMVDIFGGTPYNAATQWI 80  Lactobacillus c...
P37080         1 MVHAIFCAHGQLAGAMLDSVCMVYGEVN-VSAVAFVPGENAADIAINLEKLVS-AHTDEEWVIAVDLQCGSPWNAAAGLA 78  Klebsiella pneu...
WP_001315674   2 TIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIV 81  Escherichia coli
P26379         1 MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHEVLFLVDIFGGTPYNAAASFI 80  Bacillus subtil...
1PDO_A        81 VDKEHYEVIAGVNIPMLVETLMARdDD-PSFDELVALA 117 Escherichia coli
AAB04153      81 YDKPEMDVISGTNLPLLLEAATDL-NE-NDIQQLVSDL 116 Lactobacillus curvatus
P37080        79 MRHPQIRVISGLSLPLALELVDNQ-HT-LSADDLCQHL 114 Klebsiella pneumoniae
WP_001315674  82 VDKEHYEVIAGVNIPMLVETLMAR-DDdPSFDELVALA 118 Escherichia coli
P26379        81 AEDQRMDMAAGVNLPILLEVLSLR-EH-LALKDLLNNL 116 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap