Conserved Protein Domain Family
EII-Sor

?
TIGR00822: EII-Sor 
PTS system, mannose/fructose/sorbose family, IIC component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man (PTS splinter group) family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this family can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the sorbose-specific IIC subunits of this family of PTS transporters. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129902
View PSSM: TIGR00822
Aligned: 4 rows
Threshold Bit Score: 290.937
Threshold Setting Gi: 126220
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P08187   1 MEITTLQIVLVFIVACIAGMGSILDEFQFHRPLIACTLVGIVLGDMKTGIIIGGTLEMIALGWMNIGAAVAPDAALASII 80  Escherichia coli
P37082   1 MEISTLQIIAIFIFSCIAGMGSVLDEFQTHRPLIACTVIGLILGDLKTGVMLGGTLELIALGWMNVGAAQSPDSALASII 80  Klebsiella pneumoniae
P26381   1 --MSSLQIILLLIIAAITGIASVLDEGQTHRPLVACTLVGLVLGDLKTGIILGGTLELMALGWMNVGLAMAPDTAIASVI 78  Bacillus subtilis sub...
P42910   2 HEITLLQGLSLAALVFVLGIDFWLEALFLFRPIIVCTLTGAILGDIQTGLITGGLTELAFAGLTPAGGVQPPNPIMAGLM 81  Escherichia coli K-12
P08187  81 STILVIAGHQSIGAGIALAIPLAAAGQVLTIIVRTITVAFQHAADKAADNGNLTAISWIHVSSLFLQAMRVAIPAVIVAL 160 Escherichia coli
P37082  81 SAILVIVGHQSIAIGIAIALPVAAAGQVLTVFARTITVVFQHAADKAAEEARFRTIDLLHVSALGVQGLRVAIPALVVSL 160 Klebsiella pneumoniae
P26381  79 STILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIHRADQYAKAGNIKGIEIMHITAMVFQALRVMIPTLIVAL 158 Bacillus subtilis sub...
P42910  82 TTVIAWSTGVDAKTAIGLGLPFSLLMQYVILFFYSAFSLFMTKADKCAKEADTAAFSRLNWTTMLIVASAYAVIAFLCTY 161 Escherichia coli K-12
P08187 161 sVGTSEVQNMLNAIPEVVTNGLNIAGGMIVVVGYAMVINMMRAGYLMPFFYLGFVTAAFTNFNLVALGVIGTVMAVLYIQ 240 Escherichia coli
P37082 161 fVSADMVSSMLSAIPEFVTRGLQIAGGFIVVVGYAMVLRMMGVKYLMPFFFLGFLAGGYLDFSLLAFGGVGVIIALIYIQ 240 Klebsiella pneumoniae
P26381 159 -ISVSAVQAFLGNIPDVITKGLQIGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQ 237 Bacillus subtilis sub...
P42910 162 -LAQGAMQALVKAMPAWLTHGFEVAGGILPAVGFGLLLRVMFKAQYIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVYEF 240 Escherichia coli K-12
P08187 241 LSPKY--NRVAGAPAQAAGNNDLDNELD 266 Escherichia coli
P37082 241 LNPQW--RKAEPAASTAPSAPALDQLDD 266 Klebsiella pneumoniae
P26381 238 VMQKQsaHGAVAAASDSGSVAVYDDDDD 265 Bacillus subtilis subsp. subtilis str. 168
P42910 241 FNAKS---RQQAQPQPVASKNEEEDYSN 265 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap