Conserved Protein Domain Family
EII-GUT

?
TIGR00821: EII-GUT 
PTS system, glucitol/sorbitol-specific, IIC component
Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Gut family consists only of glucitol-specific transporters, but these occur both in Gram-negative and Gram-positive bacteria.E. coli consists of IIA protein, a IIC protein and a IIBC protein. This family is specific for the IIC component. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids, Signal transduction, PTS]
Statistics
?
PSSM-Id: 129901
View PSSM: TIGR00821
Aligned: 3 rows
Threshold Bit Score: 306.76
Threshold Setting Gi: 3914488
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P56579   1 MIETITHGAEWFIGLFQKGGEVFTGMVTGILPLLISLLVIMNALINFIGQHRIERFAQRCAGNPVSRYLLLPCIGTFVFC 80  Escherichia coli K-12
O32521   1 MIEAITHGAEWFIGLFQKGGEVFVGMVTGILPLLISLLVIMNALIVFVGQRRIEKLAQKCAGNPVTRYLVLPFIGTFVFC 80  Erwinia amylovora
O32332   1 -MDAIVYFAKGFMYLFEVGGNTFVSWVTGIIPKVLLLLVFMNSIIAFIGQDKVDRFAKFASRNVILAYGVLPFLSAFMLG 79  Clostridium beijerinc...
P56579  81 NPMTLSLGRFMPEKYKPSYYAAASYSCHSMNGLFPHINPGELFVYLGIASGLTTLNLPLGPLAVSYLLVGLVTNFFRGWV 160 Escherichia coli K-12
O32521  81 NPMTHSLGKFLPEKYKPSYYAAASYSCHSMNGLFPHINPGELFVYLGIANGLTTLGVPLGPLAVSYLLVGLITNFFRGWV 160 Erwinia amylovora
O32332  80 NPMALSMGKFLPERMKPSYYASASYHCHTNSGIFPHINVGEIFIYLGIANGITTLGLDPTALGLRYLLVGLVMNFFAGWV 159 Clostridium beijerinc...
P56579 161 TDLTTAIFEKKMGIQLEQKVH 181 Escherichia coli K-12
O32521 161 TDLTTSVFEKKMGIKLDKSVH 181 Erwinia amylovora
O32332 160 TDFTTKIVMRQQGIELSNQLK 180 Clostridium beijerinckii NCIMB 8052
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap