Conserved Protein Domain Family
malonate_madM

?
TIGR00808: malonate_madM 
malonate transporter, MadM subunit
The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM.The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129890
View PSSM: TIGR00808
Aligned: 3 rows
Threshold Bit Score: 333.774
Threshold Setting Gi: 2062657
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC45408   1 MWDILVAQLTQNGLITSFVIVGVTMYVAYMLSAKLTKGKFHGSAIAIILGLVLAYVGGAATdGGSKGLASIPMFAGVGLM 80  Malonomonas rubra
BAA36212   1 MWPIIENALEHNGLITAFAVVGAIMWLSVLLSKYLTFGRVHGSAIAIVIGLVLAWVGGTVT-GGQKGLADMALFSGIGLM 79  Pseudomonas putida
AAD01788   1 MEEIVT-VLTKNALVTALAVTGLMMYVSHLLSKYLTKGKLQSSAIAITMGLVLAYFAGVYT-QGEKGISDIAIFGGFALL 78  Acinetobacter calco...
AAC45408  81 GGSMLRDLAIVATSFGVDLREVKKSGLSGTVSLFMGIFVSFFIGAGMAIAFGYTDAVSITTIGAGAVTYIVGPVTGAAVG 160 Malonomonas rubra
BAA36212  80 GGAMLRDFAIVATAFEVQATEARKAGMIGAVALLLGTVLPFIVGAAVAYAFGYRDAVSMTTIGAGAVTYIVGPVTGAALG 159 Pseudomonas putida
AAD01788  79 GGAMLRDLAIASTAFEVDVKEVKKAGKVGMIALLLGCVIPFVIGAMVAWVMGYRDPASMTTIGAGAMTYIVGPVTGTAVG 158 Acinetobacter calco...
AAC45408 161 ADSAVVALSVAAGLVKSILVMTSTPLFAKIVGLDNPNSAMVFGGLMGTTSGVTAGLAATNPKLVPYGAMTSTFYTGLGCL 240 Malonomonas rubra
BAA36212 160 ASSDVMALSIATGLIKAILVMVFTPVSARLLALDNPRSAMVFGGLAGTVSGVTAGLAATDRRLVPYGALTATFHTGLGCL 239 Pseudomonas putida
AAD01788 159 ASSEVIALSIAIGLIKAVFFMVGTPLLAKFMYLKSPRSAMVFGGLAGTTSGTAAGLAGTDVRLVPYGALVATFYTGLGCL 238 Acinetobacter calco...
AAC45408 241 LCPSVLFLLMKGIYG 255 Malonomonas rubra
BAA36212 240 MGPSILYFCIRGLVG 254 Pseudomonas putida
AAD01788 239 LGPSVFFLTVNAIFG 253 Acinetobacter calcoaceticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap