Conserved Protein Domain Family
malonate_madL

?
TIGR00807: malonate_madL 
malonate transporter, MadL subunit
The MSS family includes the monobasic malonate:Na+ symporter of Malonomonas rubra. It consists of two integral membrane proteins, MadL and MadM. The transporter is believed to catalyze the electroneutral reversible uptake of H+-malonate with one Na+, and both subunits have been shown to be essential for activity. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129889
View PSSM: TIGR00807
Aligned: 3 rows
Threshold Bit Score: 154.188
Threshold Setting Gi: 6642781
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF20286   1 MIIYGTAILAVCHLLGVYLGNILGMALGVKANVGGVAIAMILLIISKELLAKRGHLPQVTQFGVLYWSGMYIPIVVAMSA 80  Acinetobacter calco...
AAC45407   1 MVIYGVALLSGCFLVGKVTGSWLGAAIGVKANVGGVGISMLLLVIVCDILIKKGKLKQLSQDGIGFWNAMYIPIVVAMAA 80  Malonomonas rubra
BAA36211  24 MIIYGVALLAVCTLAGVIVGDFLGVLLGVKSNVGGVGIAMILLICARLYMHRNGGMSKECEFGVGFWGAMYIPVVVAMAA 103 Pseudomonas putida
AAF20286  81 GQNVVAALSGGMLGLIVSVASLIGTVLVIRWLNKSSgdYATYEWAVE 127 Acinetobacter calcoaceticus
AAC45407  81 KQNVIGAIDGGWLALLAGGVATVVSYFMIPVISKLG--QGTKVPAIE 125 Malonomonas rubra
BAA36211 104 QQNVVTALHGGPVALLAAVGAVLVCGLTIALISRSH--RGEPLPALE 148 Pseudomonas putida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap