Conserved Protein Domain Family
rfc

?
TIGR00806: rfc 
RFC reduced folate carrier
The Reduced Folate Carrier (RFC) Family (TC 2.A.48) Members of the RFC family mediate the uptake of folate, reduce folate, derivatives of reduced folate and the drug, methotrexate. Proteins of the RFC family are so-far restricted to animals. RFC proteins possess 12 putative transmembrane a-helical spanners (TMSs) and evidence for a 12 TMS topology has been published for the human RFC. The RFC transporters appear to transport reduced folate by an energy-dependent, pH-dependent, Na+-independent mechanism. Folate:H+ symport, folate:OH- antiport and folate:anion antiport mechanisms have been proposed, but the energetic mechanism is not well defined. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129888
View PSSM: TIGR00806
Aligned: 6 rows
Threshold Bit Score: 655.027
Threshold Setting Gi: 2911843
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P42557     1 MVPTGQVAEKQACEEPRQDRELKSWRCLVFYLCFFGFMAQLRPGESFITPYLL--QQNFTIEQVTNEIIPVLPYSHLAVL 78  Chinese hamster
P41438     1 MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGESFITPFLL--ERKFTKEQVTNEIIPMLPYSHLAVL 78  house mouse
AAC61788   1 MVPTGQVGEKQACEEPRQDRELKSWRWLVFYLCFFGFMAQLRPGESFITPYLL--ERNFTKEQVTNEIIPMLPYSHLAVL 78  Norway rat
AAC04414   1 ---------------------MEQWKVMVL-ICMYGAVKEFRPTEPYMYEYQHt-VLNMSEQTLNSQVYPIWTYSYLITL 57  Caenorhabditis elegans
AAB04886   1 ---------------------MGQWKVMIL-ICLYGAVKEFRPTEPYMYEYQHt-VLNISEHTLN--------------- 42  Caenorhabditis elegans
JC2468     1 MVPSSPAVEKQVPVEPGPDPELRSWRRLVCYLCFYGFMAQIRPGESFITPYLLgpDKNFTRDEVTNEITPVLSYSYLAVL 80  human
P42557    79 VPIFLLTDYLRYKPILILQCLSFMCVWLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVRPSRYQRMASYSRAAV 158 Chinese hamster
P41438    79 VPVFLLTDYLRYKPVLVLQCLSFVCVWLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAV 158 house mouse
AAC61788  79 VPIFLLTDYLRYKPVLVLQCLSFVCVWLLLLLGTSVVHMQLMEVFYSITMAARIAYSSYIFSLVQPSRYQRMASYSRAAV 158 Norway rat
AAC04414  58 IPAFLLTDVFLYKPLLVFEAFSYFLCWVIFVFGKSVWSQQVLEVFYGWATATEIAYFAYIYVKVPKTEYKSATAFTRAAL 137 Caenorhabditis elegans
AAB04886  43 -------NVLLYKPILIIEALSYFACWMIFVFGRSVWCMQLLELFYGWATATEIAYFAYIYVKVPKEDYKSATAYTRAAL 115 Caenorhabditis elegans
JC2468    81 VPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAV 160 human
P42557   159 LLGVFTSSVLGQVLWPLEQKSqnSNMLNYISLGFIIFSLGLSLFLK-RPKHSLFFNRSALVH-KALPCELDQMHPGPGrp 236 Chinese hamster
P41438   159 LLGVFISSVLGQALVTVGHIS--TYTLNCVSLGFILFSLVLSLFLK-RPKRSLFFNRSTLAR-GALPCELDQMHPGPDrp 234 house mouse
AAC61788 159 LLGVFISSVLGQVLVTLGGIS--TYMLNCISLGFILFSLSLSLFLK-RPKRSLFFNRSALVQ-GALPCELDQMHPGPGrp 234 Norway rat
AAC04414 138 LVGRFLAYALAQLLIGLNWTS--YSTLNIISLVAMTIAVFLALILPgVEWKEAYEKKLEDNN---VQGNLKEIVDQSS-- 210 Caenorhabditis elegans
AAB04886 116 LVGRFLAYTLAQLLIGLNWAD--YMTLNIINLVSMTFAVFLAAILPhVPWRNAYQKKLEDKK---SVTDLESLVSEAK-- 188 Caenorhabditis elegans
JC2468   161 LLGVFTSSVLGQLLVTVGRVS--FSTLNYISLAFLTFSVVLALFLK-RPKRSLFFNRDDRGRcETSASELERMNPGPG-- 235 human
P42557   237 epGKLERVLG-SCRNSFLVCMLSELVGNLRQPHVRLWCLWWVFNSAGYYLIVYYVHVLW-SIDKNLN----YNGAVDAAS 310 Chinese hamster
P41438   235 etRKLDRMLG-TCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGYYLITYYVHVLWrSTDSSLS----YNGAVDAAS 309 house mouse
AAC61788 235 epRKLERMLG-TCRDSFLVRMLSELVKNVRQPQLRLWCLWWVFNSAGYYLITYYVHVLWkITDSRLN----YNGAVDAAS 309 Norway rat
AAC04414 211 ----YMDYLR-----MFFVGLRHNLMAIYRNPLILKWSVWSALSSCIFYQVTNYTQTLWgTLPESANr---YNGITEALV 278 Caenorhabditis elegans
AAB04886 189 ----YSDYLK-----LFFVELHQNLYTIYKNPLVLKWSIWSALSSCIFYQIINYTQTLWgTLPEKENk---YNGIPEALV 256 Caenorhabditis elegans
JC2468   236 --GKLGHALRvACGDSVLARMLRELGDSLRRPQLPLWSLWWVFNSAGYYLVVYYVHILWnEVDPTTNsarvYNGAADAAS 313 human
P42557   311 TLLSAITSFSAGFVKIRWALWSKLVIASVIAIQAGLVFCMYMVHyvtwvhKIWVLYMTYVLFRGAYQFLVPIATFQIASS 390 Chinese hamster
P41438   310 TLLSAITSFSAGFLSIRWTLWSKLVIAGVIAIQASLVFCMFQIR------DIWVCYVTFVLFRGAYQFLVPIATFQIASS 383 house mouse
AAC61788 310 TLLSAITAFTAGFVNIRWALWSKLVIASVIAIQAGLVFCMFQIP------DIWVCYVTFVLFRGAYQFLVPIATFQIASS 383 Norway rat
AAC04414 279 PLLGIPADLITRQLNVNWNRWGDLLLAVGSIGQAGLLFWMSQSH------HIVVLYLSYIFYRVIYQLTTTIAQSTLAFS 352 Caenorhabditis elegans
AAB04886 257 PLLGIPADLITRQMNVNWNRWGDALISVGSLLQAGLLFWMSQSH------EIIILYICYIIYRVIYQLTTTIAQSTLALT 330 Caenorhabditis elegans
JC2468   314 TLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRhp---sSIWLCYAAFVLFRGSYQFLVPIATFQIASS 390 human
P42557   391 LSKELCALVFGINTFLATALKTAITLVVSDKRGLGLKVEKQFCIYSVYFMVLS--VICFVGAVLDGVRYCRRGRHQ---- 464 Chinese hamster
P41438   384 LSKELCALVFGINTFLATALKTCITLVVSDKRGLGLQVRDQFRIYFIYFLMLS--ITCFAWAGLDGLRYCQRGRHQ---- 457 house mouse
AAC61788 384 LSKELCALVFGINTFLATALKTSITLVVSDKRGLGLQVHQQFRIYFMYFLTLS--IICLAWAGLDGLRYYRRGRHQ---- 457 Norway rat
AAC04414 353 LDSRLFGLLFGINTFVALLLQSILTAVVIDWQKL--DIRPQFVVYSCYHLVVAfgFAIIFG-IWASRRFFKTSTN----- 424 Caenorhabditis elegans
AAB04886 331 LDSRLFGLLFGINTFVALALQSILTAIVIDAEKL--AIRAQVDFHLNKNILFGsfSVCEFGRAMGNAGKGKRPTEYnvee 408 Caenorhabditis elegans
JC2468   391 LSKELCALVFGVNTFFATIVKTIITFIVSDVRGLGLPVRKQFQLYSVYFLILS--IIYFLGAMLDGLRHCQRGHHP---- 464 human
P42557   465 -PLPLPQEL--SPLENSVQVPSMQDRGLGGL---QPSAPQLLPEDG--------VEDSEASLRAEAKA 518 Chinese hamster
P41438   458 -PLAQAQELr-SPLETSVQAISLQDGDLRGP---QPSAPQLLSEDG--------MEDDRGDLRVEAKA 512 house mouse
AAC61788 458 -PLAQAQAL--SPLEDSVQAISLQDGDLRRP---QPSAPQLLPEDGs-------VEDGRADLRVEAKA 512 Norway rat
AAC04414     --------------------------------------------------------------------     Caenorhabditis elegans
AAB04886 409 dEFAPRHQRevDPEQEAQRQQVLGDRQRRMDrvaEPHWVHRMELEPtv-----sHWLDRKPLMYDFQF 471 Caenorhabditis elegans
JC2468   465 -RQPPAQGLrsAAEEKAAQALSVQDKASEACs--QPRARRFPQKTAwglwgqppWSRDRATHTCPAPA 529 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap