Conserved Protein Domain Family
mtc

?
TIGR00798: mtc 
tricarboxylate carrier
The MTC family consists of a limited number of homologues, all from eukaryotes. A single member of the family has been functionally characterized, the tricarboxylate carrier from rat liver mitochondria. The rat liver mitochondrial tricarboxylate carrier has been reported to transport citrate, cis-aconitate, threo-D-isocitrate, D- and L-tartrate, malate, succinate and phosphoenolpyruvate. It presumably functions by a proton symport mechanism. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129880
View PSSM: TIGR00798
Aligned: 11 rows
Threshold Bit Score: 389.031
Threshold Setting Gi: 861388
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB16226       5 PIGDVFVYVILLFVFMLMRQHAMDITDPRTLLSTSQDLNSAVKTLEDYGAGKIA--QLDETVWHAKKIVDSTLHPDTKEP 82  fission yeast
CAA99495       7 GPIDLPESRYDLSTYWGRIRHCAEISDPTMLLTTEKDLAHAREIISAYRHGELK--ETTPEFWRAKKQLDSTVHPDTGKT 84  baker's yeast
Q09201        12 P--DISKPKWDQGTYAGRAKHFFSSTNPLTLFSSRIQQEKCKEIVTNYKTGVISptLTVDELWKAKTLYDSTYHPDTGEK 89  Caenorhabditis ...
CAB04347      12 P--DISKPQWSQRTYYGRVRHFFTLTNPLTLTSSVARQEQCRQIVLDYKNGKVSptLTVSELWKAKTLYDSTYHPDTGEK 89  Caenorhabditis ...
CAA15970      12 P--DISKSKWDLDTYSGRVKHYFASANPMTLFTSSNTQEMCRKIVVDYKKGIINpeLTMDELWSAKILYDSVYHPDTGEK 89  Caenorhabditis ...
CAA93764      12 P--DISRPRWDQNTFQGRVNYFFSTANCLNLFVSNAKLEKARNIVLEYKQGKYDpnMTVDELWKAKTLYDSAFHPDTGEK 89  Caenorhabditis ...
CAA91477      12 P--DISKPKWDQSTFEGRAKHFFAITNPLNLFHGEKQLDEFKKIVEDYRKGSVSndLTLNQLWKAKHVVDSAFHPSTGEK 89  Caenorhabditis ...
AAB30258      42 PNINIKEPRWDQSTFIGRASHFFTVTDPKNILLTNEQLENARKVVHDYRQGIVPagLTENELWRAKYAYDSAFHPDTGEK 121 Rattus sp.
AAA68404      34 MAFDPDQPRYDQSTFYGRLRHFAGMTDPLIAFSSTTELITASELMQKCREKKPVp-ATLEELHRSQRLCQSAFHPDTGEL 112 Caenorhabditis ...
AAC24664       4 ATFSMEGSKYEMSTFLGRARYWSEAINPMLLLENERTLQKHQMLLDRWKDGQAGn-VPSADLWRARMAVESCIHPTTQEV 82  Leishmania majo...
NP_001022022  14 PKFKLGEPRFPQDTFLGRYLHCLDVIDPRTLFASNKKLEESLELLNSFKAGTATn-VPDKSLWEAQKLKSAILHPDTGEK 92  Caenorhabditis ...
CAB16226      83 VFLPFRMSCFVLTNLVVTAGMLQP--NLGTAGTVFWQWMNQSVNVAFNSANANKSTQLTLPQMTKSYIYAVSASCGVAIG 160 fission yeast
CAA99495      85 VLLPFRMSSNVLSNLVVTVGMLTP--GLGTAGTVFWQWANQSLNVAVNSANANKSHPMSTSQLLTNYAAAVTASCGVALG 162 baker's yeast
Q09201        90 MFFLGRMSAQMPGNMVTTGMLLGL--YRTLPGVVFSHWFNQSFNAVVNYTNRSGNSKATNERLFVSYCCATSGAMTVALG 167 Caenorhabditis ...
CAB04347      90 MFFLGRMSAQMPANMLINGMLLSL--YRTFPGVVFSHWINQSFNAVVNYTNRSGNSKTSNERLILSYSCATGGAMAAALS 167 Caenorhabditis ...
CAA15970      90 MFCLGRMSAQTPANMVITGMLLSC--YRTCPGIIFSHWINQSFNAIVNYTNRSGNCRTTNQQLLYSYFCATGAATTAALG 167 Caenorhabditis ...
CAA93764      90 MFILGRMSAQVPCNMLITGGMLTF--YQKLPHVIFFHWVNQSFNAIVNYTNRSGTHKQDDRTLILSYCGATTGALSCALS 167 Caenorhabditis ...
CAA91477      90 MMMVGRMSAQVPMNMAITGGMLTF--YKSPMAVIFWQWLNQSFNAVVNYTNRSGDGGSVS-QLLVSYCAATGGALTAALG 166 Caenorhabditis ...
AAB30258     122 MTLIGRMSAQVPMNMTITGCMMTF--YRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALG 199 Rattus sp.
AAA68404     113 QNFAGRMCFNVWGGTMLCGAMMIW--YKSTPAVIFWQWANQSFNALVNYTNRNAKSTLTTKDLVVSYSTAVSGALAMAIG 190 Caenorhabditis ...
AAC24664      83 IPPGFRMSMFLPMNYLVVPFMMLPstLMSVGRTVAIQWFNQSYNSAVNYANRSSDKQPVS-EILKAYTAAVVVACGGSLL 161 Leishmania majo...
NP_001022022  93 VLPPFRMSGFVPFGWITVTGMLLP--NPSWPTLLFWQWMNQSHNACVNYANRNATQPQPLSKYIGAYGAAVTAACSISGG 170 Caenorhabditis ...
CAB16226     161 LNKIVPRMNFLSSsskaVLGRLTPFAAVASAGVLNVFLMRGEELR---QGIDVFDKE-GESLGKSKKAAFYAVGETALSR 236 fission yeast
CAA99495     163 LNNLVPRLKNISPhsklILGRLVPFAAVVSAGIVNVFLMRGNEIR---KGISVFDSN-GDEVGKSKKAAFMAVGETALSR 238 baker's yeast
Q09201       168 LNKMVKNSH---G----LAARLVPFAAIALANAINIPMMRSNEAS---EGMELKDEN-DQLVGKSQKMAALSIAQVTLSR 236 Caenorhabditis ...
CAB04347     168 LNAMNKNS---------IAARLVPFAAVALANTINIPMIRSNEVT---EGLELRDEN-GELLARSRQMAILSIAQVTLSR 234 Caenorhabditis ...
CAA15970     168 LNMMVKNSH---G----LAGRLVPFVAVAVANAINIPMVRANELS---EGIELCDED-DHLVAKSKQLAALAIAQVTLSR 236 Caenorhabditis ...
CAA93764     168 FNYMLKKWKNAPP----ILARLVPFAAIAFANAINIPMMRNKEFT---NGIPVEDGE-GRTMGFSTVAPGHAIPQVVLSR 239 Caenorhabditis ...
CAA91477     167 LNSLVKKAP---P----LVGRLVPFVAVCVANSINIPMMRRGELT---EGIDILDEN-GQVIGQSPGVAQSAISQVVVSR 235 Caenorhabditis ...
AAB30258     200 LNALTKHVS---P----LIGRFVPFAAVAAANCINIPLMRQRELK---VGIPVTDEN-GTRLGESTNAAKQAITQVVISR 268 Rattus sp.
AAA68404     191 LKTYFAKKQS-SP----LAQRLVPLGAVAVANAINIPMMRQNELK---EGMTVTDAD-GNNVGVSRLAAAKAISLVVLSR 261 Caenorhabditis ...
AAC24664     162 ATMWLKRIPTGTTts-tLIRATVPFLAVSCAATVNLASMRKNEWLssgQGIRVVDDD-GVTRGTSTAAGWDSLKKCSVAR 239 Leishmania majo...
NP_001022022 171 LTYFIKKASSLPPttriIIQRFVPLPATSLASSLNVICMRWNELE---TGIQVYEKDtGKVVGVSKVAAKQAVTDTTMVR 247 Caenorhabditis ...
CAB16226     237 VINASPIMVIPPLVLMRLQKQNWLRTRPKLt----IPVNLGLITLTSLIALPLAIGVFPAREKISPFKLEPQFHHLKDKS 312 fission yeast
CAA99495     239 VINATPTMVIPPLILVRLQRGVLKGKSLGVq----TLANLGLISVTMFSALPFALGIFPQRQAIHLNKLEPELHGKKDKD 314 baker's yeast
Q09201       237 IAMAMPYMVMTPIIMNRITRTAYYRTRPWMqkyseIPIQTLIAGIGLYFTTPLCCALFPQKSSVEVEKLESSVQKEIMSR 316 Caenorhabditis ...
CAB04347     235 IAMAMPDMVMTPIIMNRITRTMYYRTRPWMky-seYPIQTMLAGMALFFTTPMCCALFPQKTAVEVTKLEASVQKEIFSR 313 Caenorhabditis ...
CAA15970     237 ILMAMPDMVLSPVIMNRFTRTAYYKARPLVqkyseMPIQTFLAGIGLYFMTPLGCALFPQRSAIHVRKLEVDVQNQILER 316 Caenorhabditis ...
CAA93764     240 VGMAVPNMVLGPVILEQLSKTAWYTPGMAA------PLQTLLCGFMLAFSTPICCALFPQKSSIQVDKLELSLQDHINKL 313 Caenorhabditis ...
CAA91477     236 IFMAVPSFAFIPVVVNALEKRPYFKANPKMf----LPLQTILCGLVLSVSTPVGCALFPQLTPVSFDQIEPELAQKIKNL 311 Caenorhabditis ...
AAB30258     269 ILMAAPGMAIPPFIMNTLEKKAFLKRFPWMs----APIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDDLQASIQKS 344 Rattus sp.
AAA68404     262 NIIVAP--CMS--EFSRYSFPVMLHASF---------------------------------------------------- 285 Caenorhabditis ...
AAC24664     240 VLWNLPCMMLPTLSAMPLMRISPFARRHSA------LTECLLQLLGLTLGVPLALAAYDLHQTIPVSKLEPRFHNLKQRD 313 Leishmania majo...
NP_001022022 248 AFLPVPLLLMPPCIMPYLERFKWVTKTQVRh----IFVNAIVCTLSFAVSLPVALALFPQESA-------ISREQLEPEL 316 Caenorhabditis ...
CAB16226     313 DQPIV--EVEFNRGL 325 fission yeast
CAA99495     315 GKPIE--KVYFNRGI 327 baker's yeast
Q09201       317 PNPPK--IVYYNKGL 329 Caenorhabditis elegans
CAB04347     314 ADAPE--VVFYNKGL 326 Caenorhabditis elegans
CAA15970     317 KDSPR--IVYYNKGL 329 Caenorhabditis elegans
CAA93764     314 ANPPK--VVYYNKGL 326 Caenorhabditis elegans
CAA91477     312 PNPPK--QLYCNKGL 324 Caenorhabditis elegans
AAB30258     345 HPELR--RVYFNKGL 357 Rattus sp.
AAA68404         ---------------     Caenorhabditis elegans
AAC24664     314 GSPVQ--TLRYYKGL 326 Leishmania major strain Friedlin
NP_001022022 317 QQKTKnsLLYYNKGL 331 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap