Conserved Protein Domain Family
lctP

?
TIGR00795: lctP 
L-lactate transport
The Lactate Permease (LctP) Family (TC 2.A.14) The only characterized member of this family, from E. coli, appears to catalyze lactate:H+ uptake. Members of this family have 12 probable TMS. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 162041
View PSSM: TIGR00795
Aligned: 10 rows
Threshold Bit Score: 515.4
Threshold Setting Gi: 2495690
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q46839         5 TQMYMpmgglGLSALVALIPIIFFFVALAVLRLKGHVAGAITLILSILIAIFAFKMPIDMAFAAAGYGFIYGLWPIAWII 84  Escherichia col...
P33231         5 QQNYDpagniWLSSLIASLPILFFFFALIKLKLKGYVAASWTVAIALAVALLFYKMPVANALASVVYGFFYGLWPIAWII 84  Escherichia col...
P55910         3 eqlydpfgneyvsalvaltpilffllaltvlkmkgilaafltlavsffvsvwafhmpvekaissvLLGIGSGLWPIGYIV 82  Bacillus subtil...
Q57251         1 ----------MLSFILSIFPIVLLIYLMVKRNALPSYVALPWVATLVMGVHLLHFNTDIVTISANVVSAIIAVQTPITVI 70  Haemophilus inf...
WP_000398024   4 YQVYDplghiWLSALVALSPIALFFISLIVFKLKGYSAGFLSLALSILIALFVYKMPVQMVSASFFYGFLYGLWPIAWIV 83  Helicobacter py...
WP_000398080   4 YQVYDplghiWLSALVALSPIALFFVSLIVFKLKGYSAGFLSLLLSIIIALFVYKMPAQMVSASFFYGFLYGLWPIAWIV 83  Helicobacter py...
WP_001288522   5 HQVYDplgniWLSALVALLPILLFFLSLMVFKLKGYTAAFLSVALSAIIAVLVYKMPVSMVGSSFLYGFLYGLWPIAWII 84  Helicobacter py...
WP_000889036   5 HQIYDplgniWLSALVALLPILLFFLSLMVFKLKGYTAAFLSVALSAVIAVLVYKMPVSMVGSSFLYGFLYGLWPIAWII 84  Helicobacter py...
WP_010878309   1 -----------MDAIVAATPILLVLFLMAGLRMSAMKAMPIGWLVTVIIALFYWKMPPEWIAAATIKGTLS-ALDILLVV 68  Archaeoglobus f...
WP_002656884   1 MNSYD--------FITALVPIILIIIGLGIIKKPAYYVIPISLIATVAIVIFYKNLGIVNTSLAMLEGALMGIWPIATVI 72  Lyme disease sp...
Q46839        85 VAAVFLYKLTVASGQFDIIRSSVISITDDQRLQVLLIGFSFGALLEGAAGFGAPVAITGALLVGLGFKPLYAAGLCLIAN 164 Escherichia col...
P33231        85 IAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLIVGFCFGAFLEGAAGFGAPVAITAALLVGLGFKPLYAAGLCLIVN 164 Escherichia col...
P55910        83 LMAVWLYKIAVKTGKFTIIRSSIAGISPDQRLQLLLIGFCFNAFLEGAAGFGVPIAISAALLVELGFKPLKAAALCLIAN 162 Bacillus subtil...
Q57251        71 FGAILFNRFSEISGATNIMRKWLGNINPNPVAQLMIIGWAFAFMIEGASGFGTPAAIAAPILVGLGFHPLKVAMLALIMN 150 Haemophilus inf...
WP_000398024  84 IAAIFLYNLSVKSGYFEILKESILSLTPDHRILVILIGFCFGSFLEGAIGFGGPVAITAAILVGLGLNPLYAAGLCLIAN 163 Helicobacter py...
WP_000398080  84 IAAIFLYNLSVKSGYFEILKESILTLTPDHRILVILIGFCFGSFLEGAIGFGGPVAITAAILVGLGLNPLYAAGLCLIAN 163 Helicobacter py...
WP_001288522  85 IAAIFLYKLSVKSGYFEILKESVQSITLDHRILVILIGFCFGSFLEGAIGFGGPIAITAAILVGLGLSPLYSAGLCLIAN 164 Helicobacter py...
WP_000889036  85 IAAIFLYKLSVKSGYFEILKESVQSITLDHRILVILIGFCFGSFLEGAIGFGGPIAITAAILVGLGLSPLYSAGLCLIAN 164 Helicobacter py...
WP_010878309  69 FGAVYLYYDARLSGATRAITRGIMGLSADRRIQAG-IAFLLVTFFEGAAGFGTPGAIVGPLLVGIGFPPAIAAPLVLIFD 147 Archaeoglobus f...
WP_002656884  73 IAAIFTYKMSEDQKDIETIKNILSNVSSDRRIIVLLVAWGFGNFLEGVAGYGTAVAIPVSILIAMGFEPFFACLICLIMN 152 Lyme disease sp...
Q46839       165 TAPVAFGALGVPILVAGQVTGID----------------------PFHIGAMAGRQLPFLSVLVPFWLVAMMDG-WKGVK 221 Escherichia col...
P33231       165 TAPVAFGAMGIPILVAGQVTGID----------------------SFEIGQMVGRQLPFMTIIVLFWIMAIMDG-WRGIK 221 Escherichia col...
P55910       163 AASGAFGAIGIPVITGAQIGDLS----------------------ALELSRTLMWTLPMISFLIPFLLVFLLDR-MKGIK 219 Bacillus subtil...
Q57251       151 SVPVSFGAVGTPTWFGFGALKLSed-------------------mILEIGSITAFIHSIAALIIPLLALRILVN-WDDIR 210 Haemophilus inf...
WP_000398024 164 TAPVAFGAVGIPITAMASVVGIP----------------------ELEISQMVGRVLPIFSIGIPFFIVFLMDG-FRGIR 220 Helicobacter py...
WP_000398080 164 TAPVAFGAVGIPITAMASVVGIP----------------------ELEISQMVGRVLPIFSIGIPFFIVFLMDG-FRGIR 220 Helicobacter py...
WP_001288522 165 TAPVAFGAVGIPISAMASAVGVP----------------------AILISAMTGKILFFVSLLVPFFIVFLMDG-FKGIK 221 Helicobacter py...
WP_000889036 165 TAPVAFGAVGIPISAMASAVGVP----------------------AILISAMTGKILFFVSLLVPFFIVFLMDG-FKGIK 221 Helicobacter py...
WP_010878309 148 SSPVSFGAVGIPVWGGLGSSLDSpvvkevlesygytlkqflytdvTFWTATLHGIMAVFIPLLGAVFMVKWSGGkVSDVK 227 Archaeoglobus f...
WP_002656884 153 TSSTAYGSVGIPITSLAQATNLD----------------------VNIVSSEIAFQLILPTLTIPFVLVILTGGgIKGLK 210 Lyme disease sp...
Q46839       222 ETWPAALVAGGSFAVTQFFTSNYIGPELPDITSALVSIVSLALFLKV-WRPKNTETAIsmGQSAGAMVVNKpssggpvps 300 Escherichia col...
P33231       222 ETWPAVVVAGGSFAIAQYLSSNFIGPELPDIISSLVSLLCLTLFLKR-WQPVRVFRFGdlGASQVDMTLAHtg------- 293 Escherichia col...
P55910       220 QTWPALLVVSGGYTAVQTLTMAVLGPELANILAALFSMGGLALFLRK-WQPKEIYREE--GAGDAGEKKAY--------- 287 Bacillus subtil...
Q57251       211 KNIVFIYISVLGCVVPYFLIAQVN-YEFPSLVGGAIGLFISVWAANR--NIGLAKVTN---TLDNNAVSAG--------- 275 Haemophilus inf...
WP_000398024 221 ETFPAVAVTGFSFAIAQFLSSNYLGPQLPDIISALVSLVATTLFLKF-WQPKHIFTSN--GKEPTISTEKH--------- 288 Helicobacter py...
WP_000398080 221 ETFPAVAVTGFSFAIAQFLSSNYLGPQLPDIISALVSLIATTLFLKF-WQPKRIFTSN--GKEPTINTEKH--------- 288 Helicobacter py...
WP_001288522 222 ETFPAVFIAAFSFAGAQFLSSNYLGPELPGIISALVSLVATALFLKF-WQPKTIFRSD--GKAISFTKTNH--------- 289 Helicobacter py...
WP_000889036 222 ETFPAVFIAAFSFAGAQFLSSNYLGPELPGIISALVSLVATALFLKF-WQPKAIFRSD--GKAASFTKSNH--------- 289 Helicobacter py...
WP_010878309 228 DAAPSLLLAGLSFAIPYWILAASLGPEFPSLLGGIIGLVIYSATLKAgFVPKTSWDFA--KKHEAGEESERi-------- 297 Archaeoglobus f...
WP_002656884 211 GVFLLTLLSGMSMAISQVFISKTLGPELPAILGSILSMTITIVYARF-FGNKETTERQ---SKNTISLSKG--------- 277 Lyme disease sp...
Q46839       301 eySLGQIIRAWSPFLILTVLVTIWTMKPFKALFAPGGAFYSLVINFQIPHLHQQVLKAAPIV--A--QPTPMDAVFKFDP 376 Escherichia col...
P33231       294 -yTAGQVLRAWTPFLFLTATVTLWSIPPFKALFASGGALYEWVINIPVPYLDKLVARMPPVV--S--EATAYAAVFKFDW 368 Escherichia col...
P55910       288 --RAADIAKAWSPFYILTAAITIWSLPAFKALFQEGGLLYQSTLLFKMPFLHQQIMKMPPIA--P--SAMPLDAVFKVDL 361 Bacillus subtil...
Q57251       276 -----EVVKALFPTGLLIAFLIVTRIHQLPFKAMMNDATIWFSTTLGSLGLFEISKGLIFSL--KniFGSNVSSSYKLLY 348 Haemophilus inf...
WP_000398024 289 --HICKVVVAWMPFVLLTITIIIWTQPWFKALFKEGGALAFSNFAFEFNSISQKIFKTVPIV--T--EATNFPVVFKLPL 362 Helicobacter py...
WP_000398080 289 --HICKVVVAWMPFVLLTITIIIWTQPWFKALFKEGGALAFSSFAFEFSSISQKIFKTVPIV--T--EATNFPVVFKLPL 362 Helicobacter py...
WP_001288522 290 --HICKIYVAWSPFVILVLVIVLWIQPFFKALFEKDGLLAFSNFYFEFNNISNHIFKSPPFVeaN--QSVNFPVVFKLLL 365 Helicobacter py...
WP_000889036 290 --HICKIYVAWSPFVILVLVIVLWIQPFFKALFEKDGLLAFSNFYFEFNNISNHIFKSPPFVeaN--QSVSFPVVFKFLL 365 Helicobacter py...
WP_010878309 298 -eKEFSILEAMVPYVLVSLGLVLTRTVPAINQFVTTNLVIGISGILGTSLS--HTYKLLYNP--G--------TIFIIAV 364 Archaeoglobus f...
WP_002656884 278 -------IIACSPYILIVTFIVLVS-P----LFNK---IHEYLKTFQS------TISIYPEA--N-------PLHFK--W 325 Lyme disease sp...
Q46839       377 LSAGGTAIFIAAIIS-IFILGVGIKKGIGVFAETLISLKWPILSIGMVLA-FAFVTNYSGMSTTLALVLAG-TGVMFPFF 453 Escherichia col...
P33231       369 FSATGTAILFAALLS-IVWLKMKPSDAISTFGSTLKELALPIYSIGMVLA-FAFISNYSGLSSTLALALAH-TGHAFTFF 445 Escherichia col...
P55910       362 LSATGTAILAAVIVTgLFSKKFSSRDAFASLKETGKELWVPIMTICFVMG-FANLANFAGLSSSIGLALAK-TGDLFPFV 439 Bacillus subtil...
Q57251       349 VPALIPFVITVLIAIpFFKISSSNVKQILVSSLQQSKNPFIALIGALVMVnLMLVGGEHSMVKIIGRTFAEiSGSNWTIF 428 Haemophilus inf...
WP_000398024 363 ILTTGTSIFLAALLS-VFLLRVKISDAIGVFGATLKEMRLPILTIGVVLA-FAYVANYSGMSATLALALAD-TGHVFTFL 439 Helicobacter py...
WP_000398080 363 ILTTGTSIFLAAILS-VFLLRVKISDAIGVFGATLKEMRLPILTIGVVLA-FAYVANYSGMSATLALALAD-TGHVFTFF 439 Helicobacter py...
WP_001288522 366 INTVGTSIFLAALVS-MLVLRVRVSDALSVFGETLKEMRYPILTIGLVLS-FAYVSNYSGISSTLALALTH-TGLAFTFF 442 Helicobacter py...
WP_000889036 366 INTVGTSIFLAALVS-MLVLRVRVSDALSVFGETLKEMRYPILTIGLVLS-FAYVSNYSGISSTLALALTH-TGLAFTFF 442 Helicobacter py...
WP_010878309 365 LISNAVSRLSPKHTA-----RALKTTAIGVAPAAIALVFAVSLSQIMMNS-GNNLSGMPSMLKVMAVSLANaTGLGYIML 438 Archaeoglobus f...
WP_002656884 326 IISPGFLIILATTIS-YSIRGVPMLKQLKIFTLTLKKMALSSFIIICIVA-ISRLMTHSGMIRDLANGISIiTGKFGPLF 403 Lyme disease sp...
Q46839       454 SPFLGWLGVFLTGSDTSSNALFGSLQSTTAQQINVSDTLLVAANTSGGVTGKMISPQSIAVACAATGMVGRESELFRYTV 533 Escherichia col...
P33231       446 SPFLGWLGVFLTGSDTSSNALFAALQATAAQQIGVSDLLLVAANTTGGVTGKMISPQSIAIACAAVGLVGKESDLFRFTV 525 Escherichia col...
P55910       440 SPVLGWIGVFITGSVVSNNALFGHLQVVTGAQIGAGSDLLLAANTAGGVMAKLVSPQSIAIAAAAVGQTGKESKLFKRTV 519 Bacillus subtil...
Q57251       429 SSFLGAIGSFFSGSNTVSNLTFGSVQLSTAETTGISVALVLALQSVGGAMGNMVCINNIVAVSSVLNISNQEGTIIKKTI 508 Haemophilus inf...
WP_000398024 440 SPMVGWLGVFLTGSDTSSNLLFGSLQMLIATQLGLPEVLFLAANTSGGVVGKMISPQSIAIACAAVGLVGKESELFRFTV 519 Helicobacter py...
WP_000398080 440 SPVVGWLGVFLTGSDTSSNLLFGSLQMLIATQLGLPEVLFLAANTSGGVVGKMISPQSIAIACAAVGLVGKESELFRFTV 519 Helicobacter py...
WP_001288522 443 SPLIGWVGVFLTGSDTSSNLLFGSLQQLTAQRLHLPEVLTLTANTVGGTLGKMISPQSIAIACAAVGLAGKESDLFKFTV 522 Helicobacter py...
WP_000889036 443 SPLIGWVGVFLTGSDTSSNLLFGSLQQLTAQRLHLPEVLTLTANTVGGTLGKMISPQSIAIACAAVGLAGKESDLFKFTV 522 Helicobacter py...
WP_010878309 439 AVFVGILGAYMSGSNTVSNILFGGFQFEIANATGLPKTIILALQNVGGAVGNMICVHNVVAVCTTCGILGQEGDVIRKNL 518 Archaeoglobus f...
WP_002656884 404 SPLIGAIGTFLTGSDTVSNVLFGPLQTQMAENIGANPYWLAAANTTGATGGKMISPQNITIATTTAGLIGQEGKLLSKTI 483 Lyme disease sp...
Q46839       534 KHSLIFASVIGIITLLQAY 552 Escherichia coli K-12
P33231       526 KHSLIFTCIVGVITTLQAY 544 Escherichia coli K-12
P55910       520 AYSLILLLIICIWTFILAR 538 Bacillus subtilis subsp. subtilis str. 168
Q57251       509 IPMIIYGIIAALGALFLVP 527 Haemophilus influenzae Rd KW20
WP_000398024 520 KYSIALAIIMGIVFTLIAY 538 Helicobacter pylori
WP_000398080 520 KYSIVLAIIMGIVFTLIAY 538 Helicobacter pylori
WP_001288522 523 KYSLIFVAIMGVVISAIAY 541 Helicobacter pylori
WP_000889036 523 KYSLIFVAIMGVVISAIAY 541 Helicobacter pylori
WP_010878309 519 VPATIYAIVVSVVAAIAVF 537 Archaeoglobus fulgidus
WP_002656884 484 IYALYYILATGLLVYLV-- 500 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap