Conserved Protein Domain Family
kup

?
TIGR00794: kup 
potassium uptake protein
Proteins of the KUP family include the KUP (TrkD) protein of E. coli, a partially sequenced ORF from Lactococcus lactis, high affinity K+ uptake systems (Hak1) of the yeast Debaryomyces occidentalis as well as the fungus, Neurospora crassa, and several homologues in plants. While the E. coli KUP protein is assumed to be a secondary transporter, and uptake is blocked by protonophores such as CCCP (but not arsenate), the energy coupling mechanism has not been defined. However, the N. crassa protein has been shown to be a K+:H+ symporter, establishing that the KUP family consists of secondary carriers. The plant high affinity (20mM) K+ transporter can complement K+ uptake defects in E. coli. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 129876
View PSSM: TIGR00794
Aligned: 5 rows
Threshold Bit Score: 810.93
Threshold Setting Gi: 267165
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAA08814 130 LAYQSVGVIYGDIGTSPLYVFSSTFT---APPTHRD---LLQVLSVVIWSITILVTFKYIFVILHADNE-GEGGTFSCYS 202 Neurospora crassa
AAC39315  48 LAFQSVGIIYGDIGTSPLYVYSSTFPd--GIKNRDD---LLGVLSLILYTLIIIPMLKYVFIVLYANDN-GDGGTFALYS 121 domesticated barley
AAB87687  28 LAYQSLGVIYGDLSTSPLYVYKTTFSg--KLSLHEDdeeIFGVFSFIFWTFTLIALFKYVFIVLSADDN-GEGGTFALYS 104 thale cress
P30016    12 ITLAAIGVVYGDIGTSPLYTLRECLSgqfGFGVERDa--VFGFLSLIFWLLIFVVSIKYLTFVMRADNA-GEGGILTLMS 88  Escherichia coli
P50505    61 LGFSSLGAIYGDIGTSPLYVLNSIKYp-nSSPTEED---IYGAISIIFYLFTFIVIFKYILIVLFLGTNdGEGGQVAIYA 136 Schwanniomyces occi...
CAA08814 203 LLTRFANITERDPREE----------VTVRMERHLTNDLK---PPTRSLRAKLEGSrFTHVlLKIIGVLAVSMVMSDGVL 269 Neurospora crassa
AAC39315 122 LISRYAKIRLIPDQQA----------EDAAVSNYHIEAPNsqlKRAQWLKQKLESS-KAAK-IVLFTLTIPSMVIGDGTL 189 domesticated barley
AAB87687 105 LLCRYAKLSILPNHQE----------MDEKLSTYATGSPGe-tRQSAAVKSFFEKHpKSQKcLLLFVLLGTCMAIGDSVL 173 thale cress
P30016    89 LAGR--NTSAR----------------------------------TTSM-------------LVIMGLIGGSFFYGEVVI 119 Escherichia coli
P50505   137 KIARSLKIGPKGVHIPgspektdlelLARAETSSSFKSSNlflNKASGFKTNPKLIkFISKfILFGCFFGCSLVMSDGLL 216 Schwanniomyces occi...
CAA08814 270 TPAQSVLGAVQGLSVVKPDISKSTVTGTTCGILVLLFLIQPLGTSKIATTFAPIVIVWLGLNFSFGIYNLVTFDWTVLKA 349 Neurospora crassa
AAC39315 190 TPAISVLSAVSGIREKAPSLTQTQVVLISVAILFMLFSVQRFGTDKVGYTFAPVISVWFLLIAGIGMYNLVVHDIGVLRA 269 domesticated barley
AAB87687 174 TPTISVLSAVSGVKLKIPNLHENYVVIIACIILVAIFSVQRYGTHRVAFIFAPISTAWLLSISSIGVYNTIKWNPRIVSA 253 thale cress
P30016   120 TPAISVMSAIEGLEIVAPQL-DTWIVPLSIIVLTLLFMIQKHGTAMVGKLFAPIMLTWFLILAGLGLRSIIA-NPEVLHA 197 Escherichia coli
P50505   217 TPTTSVLSAIAGIQIANPSF--NDVLAVSEVVLIVLFLIQQFGSNKISFTFAPIIFLWLIGLIISGIYNIVKFHPAVFKS 294 Schwanniomyces occi...
CAA08814 350 FSPYFAFQFFIEHKTRAWKMLGGVLLSFTGVEALFADLGAFSLHAIQLSWMCYTYPCLLLAYIGQAAYISHHPDAYTNPF 429 Neurospora crassa
AAC39315 270 FNPMYIVQYFIRNGKSGWVSLGGIILCVTGTEGMFADLGHFNIRAVQLSFNGILFPSVALCYIGQAAYLRKFPDNVANTF 349 domesticated barley
AAB87687 254 LSPVYMYKFLRSTGVEGWVSLGGVVLSITGVETMFADLGHFSSLSIKVAFSFFVYPCLILAYMGEAAFLSKHHEDIQQSF 333 thale cress
P30016   198 LNPMWAVHFFLEYKTVSFIALGAVVLSITGVEALYADMGHFGKFPIRLAWFTVVLPSLTLNYFGQGALLLKNPEAIKNPF 277 Escherichia coli
P50505   295 LSPYYAIQLLKHSG-ID--VFSGAMLSITGTEAMFADVGHFGRLPIQLTLTLFVYPALIICYLGQGAYIIKHPEALSNPF 371 Schwanniomyces occi...
CAA08814 430 FNAAP----PGTLYPSLVIAILAAIVASQAMITATFQLISQIMKLSYCPQVKVVHTSQTFHGQIYVPFVNWLLMLGAILV 505 Neurospora crassa
AAC39315 350 YRSIP----APMFWPTFIVAILAAIIASQAMLSGAFAILSKALSLGCMPRVRVIHTSHKYEGQVYIPEVNFLMGLANIVV 425 domesticated barley
AAB87687 334 YKAIP----EPVFWPVFIVATFAAVVGSQAVISATFSIISQCCALDCFPRVKIIHTSSKIHGQIYIPEVNWMLMCLCLAV 409 thale cress
P30016   278 FLLAP----DWALIPLLIIAALATVIASQAVISGVFSLTRQAVRLGYLSPMRIIHTSEMESGQIYIPFVNWMLYVAVVIV 353 Escherichia coli
P50505   372 FYSIPgglnSWIYWVMFVLATLSTIIASQALILGVFSITSQLINLDCFPNFKIIHVSKKYAGKVYIPAINWLLMIGVCAT 451 Schwanniomyces occi...
CAA08814 506 TAVYGDTVKLGNAYGVCVMFVTFFDTCMVTLVSLIVWKLSPFLVFVPWLVFASVDGLYLSAALIKVPEGAWFTLTLSGIL 585 Neurospora crassa
AAC39315 426 TVAFRTTTSIGHAYGICVVTTFAITTHLMTVVMLLIWKKHVMFIMLFYVVFGSIELIYLSSIMSKFIEGGYLPICFALVV 505 domesticated barley
AAB87687 410 TIGLRDTNMMGHAYGLAVTSVMLVTTCLMTLVMTIVWKQRIITVLAFVVFFGSIELLYFSSCVYKVPEGGWIPILLSLTF 489 thale cress
P30016   354 IVSFEHSSNLAAAYGIAVTGTMVLTSILSTTVARQNWHWNKYFVALILIAFLCVDIPLFTANLDKLLSGGWLPLSLGTVM 433 Escherichia coli
P50505   452 TAGFKNSNNVTAAYGLGITLDFLVTSSLIMVCMTYVYNWNILIPITYALIFLPLEVIMVISNLKKITHGAWFPLMMSGIF 531 Schwanniomyces occi...
CAA08814 586 TSLFLLWRFGKENQWRAEAEDRFKPSHLIVkdkne----------------------------------------ggrlr 625 Neurospora crassa
AAC39315 506 MSLMAAWHYVQVRRYWYELDHIVPISEMTM-------------------------------------------------- 535 domesticated barley
AAB87687 490 MAVMYIWNYGTTKKHEFDVENKVSMDRIVS-------------------------------------------------- 519 thale cress
P30016   434 FIVMTTWKSERFRLLRRMHEHGNSLEAMIAs------------------------------------------------- 464 Escherichia coli
P50505   532 MMFLSFWRWARSRKVNQDFKTRIRIGDLYPelkkqppqsetvdlndrgrpmsivnssneelveygvtlpkilktnnnqlk 611 Schwanniomyces occi...
CAA08814 626 LQPVWGgdpLSSLRGFGIFFD-------KTGVMTPAVFTHYVTKFVAIPEVAVFFHLHPVEAPTVLPEERYAVSHFTAVP 698 Neurospora crassa
AAC39315 536 LLEKNE---VRRIPGVGLLYT-------ELVQGIPPVFPRLIQKIPSVHSIFIFMSIKHLPISRVVPTERFIFRQVGPRE 605 domesticated barley
AAB87687 520 LGPSIG---MVRVPGIGLVYS-------NLVTGVPAVFGHFVTNLPAFHKILVFVCVKSVQVPYVGEEERFVISRVGPKE 589 thale cress
P30016   465 LEKSPP----VRVPGTAVYMS-------RAINVIPFALMHNLKHNKVLHERVILLTLRTEDAPYVHNVRRVQIEQLSPTF 533 Escherichia coli
P50505   612 VQSKFGlmnLKKYDGIAIMYNdssvhtlNSPNTVPQVYGKLVSSFSSIPSVFIFCSIRVLSIPTVPNDERVLIGSMKIPG 691 Schwanniomyces occi...
CAA08814 699 -GCYRLVIKHGFMDQVISP-DLAALIYEQIRRFVVRQATERMRALEKLRtge--dtDceGEGEQEaakGETSHRTessga 774 Neurospora crassa
AAC39315 606 hRMFRCVARYGYSDTLEEPkEFAAFLVDRLKMFIQEESAFALVQDQEESggagdvsDalARPRRStvhSEEAVQGqarvs 685 domesticated barley
AAB87687 590 yGMFRSVVRYGYRDVPREMyDFESRLVSAIVEFVETEPG--L-EEEEMS-------S--VRRKK-----EECME------ 646 thale cress
P30016   534 ---WRVVASYGWRETPN-------------VEEVFHRCG-----LEGLS------------CRM---------------- 564 Escherichia coli
P50505   692 --HYRCIIRYGFMEEILIDkELNNHILNSIPDINELAIKFNLNNKCILT----------KPCTIP---ILHIFEN----- 751 Schwanniomyces occi...
CAA08814 775 sgpdgvllpvelrdeeaAAELArld-rayASKILYVVGKEQMRIKTGAPIARRFMLS-VFLWIRDNTRAKIANLQLA--- 849 Neurospora crassa
AAC39315 686 shsas--grmsfhtsqaVEEEKqlidrevERGMVYLMGEANVTAEAKSSILKKIVVNhVYTFLRKNLTEGHKVLAIP--- 760 domesticated barley
AAB87687 647 -----------------IMEAK-------EAGVAYILGHSYAKAKQSSSVLKKLAVNvVFAFMSTNCRGTDVVLNVP--- 699 thale cress
P30016   565 ------------------METS------------FFMSHESLILGKR-PWYLRLRGK-LYLLLQRNALRAPDQFEIP--- 609 Escherichia coli
P50505   752 ------------------NLIR-------SHDYSSEEHETKNPLVKCKRFIRKILINhIFSPIYSDFQSNGKFLKISded 806 Schwanniomyces occi...
CAA08814 850 --TDRLVEVGFVKEI 862 Neurospora crassa
AAC39315 761 --KDQLLKVGITYEI 773 domesticated barley
AAB87687 700 --HTSLLEVGMVYYV 712 thale cress
P30016   610 --PNRVIELGTQVEI 622 Escherichia coli
P50505   807 eeSEKKMFLGGVVRI 821 Schwanniomyces occidentalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap