Conserved Protein Domain Family
gntP

?
TIGR00791: gntP 
gluconate transporter
This family includes known gluconate transporters of E. coli and Bacillus species as well as an idonate transporter from E. coli. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129873
View PSSM: TIGR00791
Aligned: 8 rows
Threshold Bit Score: 502.272
Threshold Setting Gi: 1169988
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P39357     1 MPLIIVVAG--IALLLLLTIKIKLNTFVSLIIVSIAVAIASGMDLSKVVTSVESGLGGTLGHIGLIFGFGVMLGRLLADA 78  Escherichia coli K-12
P12012     1 MPLIIVALG--ILALLFLIMGLKLNTFISLLVVSFGVALALGMPFDKVVSSIEAGIGGTLGHIALIFGLGAMLGKLIADS 78  Bacillus subtilis s...
P46832     1 MPLLIVAIG--IVALLLLIMGLKLNTFVSLIIVSFGVALALGMPLDDIVKTIEEGLGGTLGHIALIFGLGAMLGRLIADS 78  Bacillus licheniformis
P39344     1 MPLIIIAAG--VALLLILMIGFKVNGFIALVLVAAVVGFAEGMDAQAVLHSIQNGIGSTLGGLAMILGFGAMLGKLISDT 78  Escherichia coli K-12
P39373     4 LNILWVVFG--IGLMLVLNLKFKINSMVALLVAALSVGMLAGMDLMSLLHTMKAGFGNTLGELAIIVVFGAVIGKLMVDS 81  Escherichia coli
P46858     4 LTLVLTAVGs-VLLLLFLVMKARMHAFLALMVVSMGAGLFSGMPLDKIAATMEKGMGGTLGFLAVVVALGAMFGKILHET 82  Escherichia coli
P08555     4 QIWVVSTLLisIVLIVLTIVKFKFHPFLALLLASFFVGTMMGMGPLDMVNAIESGIGGTLGFLAAVIGLGTILGKMMEVS 83  Escherichia coli K-12
AAA58213   1 MPLVIVAIG--VILLLLLMIRFKMNGFIALVLVALAVGLMQGMPLDKVIGSIKAGVAD-VGSLALIMGFGAMLGKMLADC 77  Escherichia coli st...
P39357    79 GGAQRIALTMLNYFGKNKLDWAVVCSAFIVGIALFFEVGLILLVPILFAIAREAKISPMFMCVPMLSGLLVAHGFLPPHP 158 Escherichia coli K-12
P12012    79 GGAQRIAMTLVNKFGEKNIQWAVVIASFIIGIALFFEVGLVLLIPIVFAISRELKISILFLGIPMVAALSVTHGFLPPHP 158 Bacillus subtilis s...
P46832    79 GGAQRIAMTLVNKFGEENIQWAVVIASFIIGVALFFEVALVLLIPIVFAISKELEISISYLGIPMTAALSVTHGFLPPHP 158 Bacillus licheniformis
P39344    79 GAAQRIATTLIATFGKKRVQWALVITGLVVGLAMFFEVGFVLLLPLVFTIVASSGLPLLYVGVPMVAALSVTHCFLPPHP 158 Escherichia coli K-12
P39373    82 GAAHQIAHTLLARLGLRYVQLSVIIIGLIFGLAMFYEVAFIMLAPLVIVIAAEAKIPFLKLAIPAVAAATTAHSLFPPQP 161 Escherichia coli
P46858    83 GAVDQIAVKMLKSFGHSRAHYAIGLAGLVCALPLFFEVAIVLLISVAFSMARHTGTNLVKLVIPLFAGVAAAAAFLVPGP 162 Escherichia coli
P08555    84 GAAERIGLTLQRCRWLS-VDVIMVLVGLICGITLFVEVGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHP 162 Escherichia coli K-12
AAA58213  78 GGAQRIATTLIAKFGKKHIQWAVVLTGFTVGFALFYEVGFVLMLPLVFTIAASANIPLLYVGVPMAAALSVTHGFLPPHP 157 Escherichia coli st...
P39357   159 GPTVIAREYGADVGLVLIYGIIVGIPTFILCGPVLNKFCQRIIPDAFKkegniASLGATRRFSESEMPGFGISFLTAMLP 238 Escherichia coli K-12
P12012   159 GPTAIAGEYGANIGEVLLYGFIVAVPTVLIAGPLFTKFAKKIVPASFAkngniASLGTQKTFNLEETPGFGISVFTAMLP 238 Bacillus subtilis s...
P46832   159 GPTAIAGELGANIGEVLLYGIIVAIPTVLLAGPLFTKLAKKIVPQSFEkmgsiASLGEQKTFKLEETPGFGISVFTAMLP 238 Bacillus licheniformis
P39344   159 GPTAIATIFEANLGTTLLYGFIITIPTVIVAGPLFSKLLTRFEKAPPE-----G-LFNPHLFSEEEMPSFWNSIFAAVIP 232 Escherichia coli K-12
P39373   162 GPVALVNAYGADMGMVYIYGVLVTIPSVICAGLILPKFLGNLERPTPS-----F-LKADQPVDMNNLPSFGVSILVPLIP 235 Escherichia coli
P46858   163 APMLLASQMNADFGWMILIGLCAAIPGMIIAGPLWGNFISRYVELHIP------DDISEPHLGEGKMPSFGFSLSLILLP 236 Escherichia coli
P08555   163 AALYVANKLGADIGSVIVYGLLVGLMASLIGGPLFLKFLGQRLPFKPVp----TEFADLKVRDEKTLPSLGATLFTILLP 238 Escherichia coli K-12
AAA58213 158 GPTAIATIFNADMGKTLLYGTILAIPTVILAGPVYARVLKGIDKPIPE-----G-LYSAKTFSEEEMPSFGVSVWTSLVP 231 Escherichia coli st...
P39357   239 VILMAVVTIIQMTHAKSaadsGLFYNVILFLGNSTIAMLISLLFAIYTMGLGRGKTIPDLMDSCGKAIAGIAGLLLIIGG 318 Escherichia coli K-12
P12012   239 IIIMSVATIIDLLQETIgfadNGVLAFIRLIGNASTAMIISLLVAVYTMGIKRNIPVKTVMDSCSTAISQIGMMLLIIGG 318 Bacillus subtilis s...
P46832   239 VIIMSISTVITLIQETMgladNSLLAAVRLIGNASTSMVISLLVAIYTMGIARKIPIKQVMDSCSTAITQIGMMLLIIGG 318 Bacillus licheniformis
P39344   233 VILMAIAAVCEITLPKT----NTVRLFFEFVGNPAVALFIAIVIAIFTLGRRNGRTIEQIMDIIGDSIGAIAMIVFIIAG 308 Escherichia coli K-12
P39373   236 AIIMISTTIANIWLVKD----TPAWEVVNFIGSSPIAMFIAMVVAFVLFGTARGHDMQWVMNAFESAVKSIAMVILIIGA 311 Escherichia coli
P46858   237 LVLVGLKTIAARFVPEG----STAYEWFEFIGHPFTAILVACLVAIYGLAMRQGMPKDKVMEICGHALQPAGIILLVIGA 312 Escherichia coli
P08555   239 IALMLVKTIAELNMARE----SGLYILVEFIGNPITAMFIAVFVAYYVLGIRQHMSMGTMLTHTENGFGSIANILLIIGA 314 Escherichia coli K-12
AAA58213 232 VVLMAMRAIAEMILPKG----HAFLPVAEFLGDPVMATLIAVLIAMFTFGLNRGRSMDQINDTLVSSIKIIAMMLLIIGG 307 Escherichia coli st...
P39357   319 GGAFKQVLIDSGVGQYISTLVSGMDINPILMAWGVAAFLRICLGSATVAAISTAG-----LVIPLLAv--HPNTNLALIT 391 Escherichia coli K-12
P12012   319 GGAFKQVLINGGVGDYVADLFKGTALSPIILAWLIAAILRISLGSATVAALSTTG-----LVIPLLG---HSDVNLALVV 390 Bacillus subtilis s...
P46832   319 GGAFKQVLINGGVGDYVAELFKGTAMSPILLAWVIAAILRISLGSATVAALSTTG-----LVLPMLG---QSDVNLALVV 390 Bacillus licheniformis
P39344   309 GGAFKQVLVDSGVGHYISHLMTGTTLSPLLMCWTVAALLRIALGSATVAAITTAG-----VVLPIIN---VTHADPALMV 380 Escherichia coli K-12
P39373   312 GGVLKQTIIDTGIGDTIGMLMSHGNISPYIMAWLITVLIRLATGQGVVSAMTAAGiisaaILDPATGq--LVGVNPALLV 389 Escherichia coli
P46858   313 GGVFKQVLVDSGVGPALGEALTGMGLPIAITCFVLAAAVRIIQGSATVACLTAVG-----LVMPVIEqlnYSGAQMAALS 387 Escherichia coli
P08555   315 GGAFNAILKSSSLADTLAVILSNMHMHPILLAWLVALILHAAVGSATVAMMGATA-----IVAPMLPl--YPDISPEIIA 387 Escherichia coli K-12
AAA58213 308 GGAFKQVLVDSGVDKYIASMMHETNISPLLMAWSIAAVLRIALGSATVAAITAGG-----IAAPLIA---TTGVSPELMV 379 Escherichia coli st...
P39357   392 LATGAGSCICSHVNDASFWMIKDFFGLTTKETLLSWTLMSTLLSISGLIFILLASLVL 449 Escherichia coli K-12
P12012   391 LATGAGSVIASHVNDAGFWMFKEYFGLSMKETFATWTLLETIISVAGLGFILLLSLVV 448 Bacillus subtilis subsp. subtilis str. 168
P46832   391 LATGAGSVIASHVNDAGFWMFKEYFGLSMKETFATWTLLETIIAVAGLGFTLLLSLFV 448 Bacillus licheniformis
P39344   381 LATGAGSVIASHVNDPGFWLFKGYFNLTVGETLRTWTVMETLISIMGLLGVLAINAVL 438 Escherichia coli K-12
P39373   390 LATAAGSNTLTHINDASFWLFKGYFDLSVKDTLKTWGLLELVNSVVGLIIVLIISMVA 447 Escherichia coli
P46858   388 ICIAGGSIVVSHVNDAGFWLFGKFTGATEAETLKTWTMMETILGTVGAIVGMIAFQLL 445 Escherichia coli
P08555   388 IAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKYYTTATFIASVVALAGTFLLSFII 445 Escherichia coli K-12
AAA58213 380 IAVGSGSVIFSHVNDPGFWLFKEYFNLTIGETIKSWSMLETIISVCGLVGCLLLNMVI 437 Escherichia coli str. K-12 substr. MG1655
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap