Conserved Protein Domain Family
flhB_rel

?
TIGR00789: flhB_rel 
flhB C-terminus-related protein
This model describes a short protein (80-93 residues) homologous to the C-terminus of the flagellar biosynthetic protein FlhB. It is found so far only in species that also have FlhB. In a phylogenetic tree based on alignment of both this family and the homologous region of FlhB and its homologs, the members of this family form a monophyletic set. [Unknown function, General]
Statistics
?
PSSM-Id: 129871
View PSSM: TIGR00789
Aligned: 5 rows
Threshold Bit Score: 116.776
Threshold Setting Gi: 499184814
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB73113      7 SIKKAVALGYQKEKNSAPKVLASGKGESAAKIISLAKEHGVPIKEDEDLIEILSKLDLGDEIPPNMYKAVAEVFAFIYQM 86  Campylobacter je...
WP_001044046  3 KTIKAAALAYNMGQDHAPKVIASGVGEVAKRIIQKAKEYDIALFSNPMLVDSLLKVELDCAIPEELYESVVQVFLWLNSV 82  Helicobacter pylori
WP_004082188  5 EIKKAVALKYDPTRTSAPEVVAKGVGEVAERIIEMARRHGIPIEERPDIIDDLLRLDLFSEIPEEMYLVIAEIYAFLKRY 84  Thermotoga
WP_010882354  4 KRACSVALSYATG-DKAPIIVASGTGAIAEKIVEIAKKFDIALVQDELLARVLSEHRIGACIPPETYQVVSAIFAFLYTQ 82  Treponema
WP_003232001  6 PIRKAVALHYDEQKDKAPRVIATGKGHVADNIIKEAKKAGVPIQEDRTLVELMRHLTVDDQIPEALYETVAEIFSFIYKL 85  Bacillales
CAB73113     87 AN 88  Campylobacter jejuni subsp. jejuni NCTC 11168
WP_001044046 83 EN 84  Helicobacter pylori
WP_004082188 85 DK 86  Thermotoga
WP_010882354 83 Q- 83  Treponema
WP_003232001 86 DE 87  Bacillales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap