Conserved Protein Domain Family
citMHS

?
TIGR00784: citMHS 
citrate transporter, CitMHS family
This family includes two characterized citrate/proton symporters from Bacillus subtilis. CitM transports citrate complexed to Mg2+, while the CitH apparently transports citrate without Mg2+. The family also includes uncharacterized transporters, including a third paralog in Bacillus subtilis. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 162036
View PSSM: TIGR00784
Aligned: 3 rows
Threshold Bit Score: 606.08
Threshold Setting Gi: 1934633
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB80885   1 MLTILGFSMVTVFTILIMTKKVSPIVALTITPIVFALIGGFG-KGIGDMILEGIQTVASSAALLLFAILFFGILIDAGLF 79  Bacillus subtilis s...
P55069     1 MLAILGFLMMLVFMALIMTKRLSVLTALVLTPIVFALIAGFGfTEVGDMMISGIQQVAPTAVMIMFAILYFGIMIDTGLF 80  Bacillus subtilis s...
P42308     1 MLAILGFVMMIVFMYLIMSNRLSALIALIVVPIVFALISGFG-KDLGEMMIQGVTDLAPTGIMLLFAILYFGIMIDSGLF 79  Bacillus subtilis s...
AAB80885  80 DPLIEKILSIVKGDPVKIAIGSAVLAMLIALDGDGTTTYMITVSAMLPLYKRIGMNPMVMATLAMLSLSIVSgMTPWGGP 159 Bacillus subtilis s...
P55069    81 DPMVGKILSMVKGDPLKIVVGTAVLTMLVALDGDGSTTYMITTSAMLPLYLLLGIRPIILAGIAGVGMGIMN-TIPWGGA 159 Bacillus subtilis s...
P42308    80 DPLIAKILSFVKGDPLKIAVGTAVLTMTISLDGDGTTTYMITIAAMLPLYKRLGMNRLVLAGIAMLGSGVMN-IIPWGGP 158 Bacillus subtilis s...
AAB80885 160 ATRAISVLGLDPSDFFVPLLPTMLGGIACVIFLAFLMGRKERNRIGIVQLEPRhitkdSSQSYMAATLESEqLKRPRLIY 239 Bacillus subtilis s...
P55069   160 TPRAASALGVDPAELTGPMIPVIASGMLCMVAVAYVLGKAERKRLGVIELKQP-----ANANEPAAAVEDE-WKRPKLWW 233 Bacillus subtilis s...
P42308   159 TARVLASLKLDTSEVFTPLIPAMIAGILWVIAVAYILGKKERKRLGVISIDH------APSSDPEAAP----LKRPALQW 228 Bacillus subtilis s...
AAB80885 240 LNLFLVISIMVFIVLGTKHPSVLFLIGFVLALTINYPNVKMQKERIAEHSGNAITVVLLVFSAGVFAGILSGTKMVDAIA 319 Bacillus subtilis s...
P55069   234 FNLLLTLSLIGCLVSGKVSLTVLFVIAFCIALIVNYPNLEHQRQRIAAHSSNVLAIGSMIFAAGVFTGILTGTKMVDEMA 313 Bacillus subtilis s...
P42308   229 FNLLLTVALMAALITSLLPLPVLFMTAFAVALMVNYPNVKEQQKRISAHAGNALNVVSMVFAAGIFTGILSGTKMVDAMA 308 Bacillus subtilis s...
AAB80885 320 GSLISIIPSSMGGFFPVIVALTSIPFTFVLSNDAYYFGMVPIFAEAASAYGIEPVEIARASIMGQPVHLMSPLVASTVLL 399 Bacillus subtilis s...
P55069   314 ISLVSMIPEQMGGLIPAIVALTSGIFTFLMPNDAYFYGVLPILSETAVAYGVDKVEIARASIIGQPIHMLSPLVPSTHLL 393 Bacillus subtilis s...
P42308   309 HSLVSLIPDAMGPHLPLITAIVSMPFTFFMSNDAFYFGVLPIIAEAASAYGIDAAEIGRASLLGQPVHLLSPLVPSTYLL 388 Bacillus subtilis s...
AAB80885 400 VSMLKMDLGSFQRFAVKWAVITSLVITLLAIITGAITIL 438 Bacillus subtilis subsp. subtilis str. 168
P55069   394 VGLVGVSIDDHQKFALKWAVLAVIVMTAIALLIGAISIS 432 Bacillus subtilis subsp. subtilis str. 168
P42308   389 VGMAGVSFGDHQKFTIKWAVGTTIVMTIAALLIGIISF- 426 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap