Conserved Protein Domain Family
ccs

?
TIGR00783: ccs 
citrate carrier protein, CCS family
These proteins are members of the Citrate:Cation Symporter (CCS) Family (TC 2.A.24). These proteins have 12 GES predicted transmembrane regions. Most members of the CCS family catalyze citrate uptake with either Na+ or H+ as the cotransported cation. However, one member is specific for L-malate and probably functions by a proton symport mechanism. [Unclassified, Role category not yet assigned]
Statistics
?
PSSM-Id: 129865
View PSSM: TIGR00783
Aligned: 8 rows
Threshold Bit Score: 366.703
Threshold Setting Gi: 623057
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31604    91 AYFVYAGIFTQKEIDAISNVMDK-SNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVG-ASLFGIVIGLCFGI 168 Salmonella typhimurium
P31602    91 AYFVYAGIFTQKEIDAISNVMDK-SNFLNLFIAVLITGAILSVNRRLLLKSLLGYIPTILMGIVG-ASIFGIAIGLVFGI 168 Klebsiella pneumoniae
AAB18291  91 SIMVFFNLLNQNVLDSTDILMKQ-ANFLYFYIACLVCGSILGMNRKILVQGLMRMIVPMALGMIL-AMGVGTLVGTLLGL 168 Streptococcus equinus
CAB07940  98 SFLVFYNVLNSTSLDAVTNLMKT-SNFLYFYIACLVVGSILGMNRIVLIQGFIRMFVPLVAGTIA-AVAAGILVGFIFGY 175 Bacillus subtilis s...
AAA60396  95 AILVATNVMPKYVVTTASGFING-MDFLGLYIVSLIASSLFKMDRKMLLKAAVRFLPVAFISMALtAVVIG-IVGVIIGV 172 Leuconostoc mesente...
AAC43505  95 AILVATNVMPKYVVTTASGFING-MDFLGLYIVSLIASSLFKMDRKMLLKAAVRFLPVAFISMALtAVVIG-IVGVIIGV 172 Leuconostoc lactis
CAA53590  77 TLLSFFHIVPSNVIGAVSNFMGGkFGFLDFYIAALICGSILGMNRNLLVKASKKFIPIALITMVIgFFSVG-LVGMLIGN 155 Lactococcus lactis
BAA11726 100 SAVVYYHLLPNDIVKSTTEFTEN-SNFLYLFIAGIVVGSILGMKRETLVKAFMKIFIPLIVGSVT-AAIVGLAVGTLLGL 177 Bacillus subtilis
P31604   169 PVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRS-REEYYSTAIAILTIANIFAIIFAALLDMIGKKYTWLSGEGELV 247 Salmonella typhimurium
P31602   169 PVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRS-REEYYSTAIAILTIANIFAIVFAAVLDIIGKKHTWLSGEGELV 247 Klebsiella pneumoniae
AAB18291 169 GWKHSLFYIVTPVLAGGIGEGILPLSLGYSAITGLP-SEQLVGQLIPATIIGNFFAIMCSGLLSRLGEKRPELSGQGQLI 247 Streptococcus equinus
CAB07940 176 SAYDSFFFVVVPIIAGGIGEGILPLSIAYSQILGSS-ADVFVSQLVPAAIIGNVFAIICAALMKKLGDKRPDLNGNGRLV 254 Bacillus subtilis s...
AAA60396 173 GFNYAILYIAMPIMAGGVGAGIVPLSGIYAHAMGVG-SAGILSKLFPTVILGNLLAIISAGLISRIFKD-SKGNGHGEIL 250 Leuconostoc mesente...
AAC43505 173 GFNYAILYIAMPIMAGGVGAGIVPLSGIYAHAMGVG-SAGILSKLFPTVILGNLLAIISAGLISRIFKD-SKGNGHGEIL 250 Leuconostoc lactis
CAA53590 156 GFADSVMYVSMPMMSGGMGAGITPLSQIYAAGLAHGnQAAIFSQLAPAVTFGNILAIIGALSIAKVFNK-SKYNGHGTLV 234 Lactococcus lactis
BAA11726 178 GFQHTLLYIVIPIMAGGVGEGAIPLSIGYSDIMPIS-QGEAFALVLPSIMLGSLCAIILAGLLNRIGKKKPEWTGNGKVD 256 Bacillus subtilis
P31604   248 RKAsfKTEDDEKAGQITHRETAVGMVLSTTCFLLAYVVAKKIL-PSIGGVSIhyFAWMVLIVAALNASGLCSPEIKAGAK 326 Salmonella typhimurium
P31602   248 RKAsfKVEEDEKTGQITHRETAVGLVLSTTCFLLAYVVAKKIL-PSIGGVAIhyFAWMVLIVAALNASGLCSPEIKAGAK 326 Klebsiella pneumoniae
AAB18291 248 KIT--NSDDLSDALEEDKAPIDVKLMGAGVLIACTLFITGGLL-QHLTGFPG--PVLMIVVAAFLKYLNVVPKETQRGSK 322 Streptococcus equinus
CAB07940 255 KSK--KANEIFNQKE-AEAKIDFKLMGAGVLLACTFFIFGGLL-EKFIFIPG--AILMIISAAAVKYANILPKKMEEGAY 328 Bacillus subtilis s...
AAA60396 251 RGE---REDAAAAAE--EIKPDYVQLGVGLIIAVMFFMIGTMLnKVFPGINA--YAFIILSIVLTKAFGLLPKYYEDSVI 323 Leuconostoc mesente...
AAC43505 251 RGE---RED--AAAE--EIKPDYVQLGVGLIIAVMFFMIGTMLnKVFPGINA--YAFIILSIVLTKAFGLLPKYYEDSVI 321 Leuconostoc lactis
CAA53590 235 AAT---KEE--LAKP--KIKLDAQQIGTGMLFAFALLMAGDILnKFFPNIHQ--YAFMIIIVFILKATNTVPKDLEESVV 305 Lactococcus lactis
BAA11726 257 RSE--EESPALEESQSGQQMFNLSLFASGGILAVSLYLVGMLA-HDFFGFPA--PVAMLLLAVLIKLFRLVPASIENGAF 331 Bacillus subtilis
P31604   327 RLSDFFSKQLLWVLMVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCMANRGGSG 406 Salmonella typhimurium
P31602   327 RLSDFFSKQLLWVLMVGVGVCYTDLQEIINAITFANVVIAAIIVIGAVLGAAIGGWLMGFFPIESAITAGLCMANRGGSG 406 Klebsiella pneumoniae
AAB18291 323 QLYKFISGNFTFPLMVGLGMLYIPLKDVVGMLSWQYFVVVISVVFTVIATGFFVSRFMNMNPVEAAIVS-ACQSGMGGTG 401 Streptococcus equinus
CAB07940 329 QLYKFISSSFTWPLMVGLGILFIPLDDVASVISIPFVIICISVVIAMIGSGYFVGKLMNMYPVESAIVT-CCHSGLGGTG 407 Bacillus subtilis s...
AAA60396 324 MFGQVIVKNMTHALLAGVGLSLLDMHVLLAALSWQFVVLCLVSIVAISLISATLGKLFGLYPVEAAITAGLANNSMGGTG 403 Leuconostoc mesente...
AAC43505 322 MFGQVIVKNMTHALLAGVGLSLLDMHVLLAALSWQFVVLCLVSIVAISLISATLGKLFGLYPVEAAITAGLANNSMGGTG 401 Leuconostoc lactis
CAA53590 306 MFNQVIMTNLTHAVLAGIGLALIDLNTLASAFTWQFVVLCLTSVVVMGLASWFLARLFGLYPVETAIGAGMINNSMGGTG 385 Lactococcus lactis
BAA11726 332 GVSRFFSTAVTYPLLFAIGVSMTPWDKLVAAFNLSNIITILSVVVTMMAVGFFTGKWLNMYPIETAIIN-ACHSGQGGTG 410 Bacillus subtilis
P31604   407 DLEVLSACNRMNLISYAQISSRLGGGIVLVIASIV 441 Salmonella typhimurium
P31602   407 DLEVLSACNRMNLISYAQISSRLGGGIVLVIASIV 441 Klebsiella pneumoniae
AAB18291 402 DVAILSTANRMTLMPFAQVATRLGGAITVITMTAI 436 Streptococcus equinus
CAB07940 408 DVAILSASGRMGLMPFAQISTRLGGAGTVICATVL 442 Bacillus subtilis subsp. subtilis str. 168
AAA60396 404 NVAVLAASERMNLIAFAQMGNRIGGALILVVAGIL 438 Leuconostoc mesenteroides subsp. mesenteroides
AAC43505 402 NVAVLAASERMNLIAFAQMGNRIGGALILVVAGIL 436 Leuconostoc lactis
CAA53590 386 NIAVLSASDRMEMIAFAQMANRLCGAIVLIFGGIL 420 Lactococcus lactis
BAA11726 411 DVAILSAAERLELMPFAQVSTRIGGAITVSLTLLL 445 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap